BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021702 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 33 0.25 SB_55702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_46908| Best HMM Match : MORN (HMM E-Value=2.52234e-44) 29 4.1 SB_45715| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 5.4 SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_19455| Best HMM Match : Amino_oxidase (HMM E-Value=0.0003) 28 7.2 SB_18583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_14735| Best HMM Match : Sushi (HMM E-Value=1.8e-07) 28 7.2 SB_8179| Best HMM Match : zf-B_box (HMM E-Value=0.28) 28 7.2 SB_53446| Best HMM Match : Neur_chan_memb (HMM E-Value=0.038) 28 7.2 SB_36390| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +1 Query: 124 AAPAVKKDVRIQSSVLPNKTFVAALDNGSPVTRVTIAFKAGSR 252 A +V++ +Q + L N VA+L+ SP++RV + F AGSR Sbjct: 20 AKGSVRERQTVQVTTLDNGLKVASLETYSPISRVGLFFDAGSR 62 >SB_55702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G + ST++G Sbjct: 45 LWRDENRRTRRKTLGAKVRPTNSTHVG 71 >SB_46908| Best HMM Match : MORN (HMM E-Value=2.52234e-44) Length = 241 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 266 GLWF*REPALKAIVTRVTGEPLSKAA 189 GLW P ++A+V R+ G+P+++ A Sbjct: 148 GLWVSGRPEMEAVVLRIVGKPVAEVA 173 >SB_45715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G + ST++G Sbjct: 70 LWRDENRRTRRKTLGAKVRPTNSTHVG 96 >SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1296 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +3 Query: 6 VNHKPLLRYYLKFLKTYENGIQNSRRPLYSSCYDQGLRPSCAGSKER 146 VN + L L+ + E GI RR LYS C+D+ +R ER Sbjct: 139 VNLQEQLDMRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAER 185 >SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 157 QSSVLPNKTFVAALDNGSPVTRVTIAFKAGS 249 Q S L N T+ DNGSP+T V I GS Sbjct: 546 QFSHLVNLTWKLGRDNGSPITHVIIQQHVGS 576 >SB_19455| Best HMM Match : Amino_oxidase (HMM E-Value=0.0003) Length = 658 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G ST++G Sbjct: 599 LWRDENRRTRRKTLGAKARPTNSTHVG 625 >SB_18583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G ST++G Sbjct: 57 LWRDENRRTRRKTLGAKARPTNSTHVG 83 >SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1277 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G ST++G Sbjct: 1248 LWRDENRRTRRKTLGAKARPTNSTHVG 1274 >SB_14735| Best HMM Match : Sushi (HMM E-Value=1.8e-07) Length = 305 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G ST++G Sbjct: 77 LWRDENRRTRRKTLGAKARPTNSTHVG 103 >SB_8179| Best HMM Match : zf-B_box (HMM E-Value=0.28) Length = 336 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G ST++G Sbjct: 285 LWRDENRRTRRKTLGAKARPTNSTHVG 311 >SB_53446| Best HMM Match : Neur_chan_memb (HMM E-Value=0.038) Length = 406 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 619 LWRDEERVTQSTTIGCLMEQIYSTNLG 539 LWRDE R T+ T+G ST++G Sbjct: 355 LWRDENRRTRRKTLGAKARPTNSTHVG 381 >SB_36390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 563 LHKAAYRRGLGNSLFISPKRINDISSESLQLFASQNITPSRCA 691 LH A RR S I+ R + ES+++ A QN+ PSR A Sbjct: 83 LHMDA-RRKESRSDIIAKNRSLTLDGESIRITAKQNVPPSRSA 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,975,704 Number of Sequences: 59808 Number of extensions: 472529 Number of successful extensions: 994 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 994 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -