BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021702 (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 24 1.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.4 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 7.2 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 9.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 9.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 9.5 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 573 QPIVVDWVTRSSSRQR 620 QPI W+TRS +R++ Sbjct: 81 QPISYKWITRSGTREQ 96 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.4 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 524 IISLPPQIRAVDLLHKAAYRRGLGNSLFISPKRIND--ISSESLQLFAS 664 +I L Q+ + +H ++ R L +S+F +R+N +S L LF S Sbjct: 294 MICLNGQVLKRESIHNSSNARFLMDSMFDFAERVNSLRLSDAELGLFCS 342 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/21 (28%), Positives = 14/21 (66%) Frame = +2 Query: 29 ILPKVSKNLRKWHPKLSSPPL 91 +LPK++ + +W+P + P+ Sbjct: 519 VLPKLTLEVEEWNPLTDTVPI 539 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +2 Query: 224 SQSPSKLALVRTTSRIGIVACTTISCWTNYQ 316 +QS +K +G+V + + CW +Q Sbjct: 302 TQSLAKAVSKNGVLFVGLVGNSAVGCWNEHQ 332 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 51 TYENGIQNSRRPLYSS 98 TY NG+ +RP++S+ Sbjct: 300 TYSNGLPFPQRPIWSN 315 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 51 TYENGIQNSRRPLYSS 98 TY NG+ +RP++S+ Sbjct: 300 TYSNGLPFPQRPIWSN 315 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 224 SQSPSKLALVRTTSRIGIVACTTISCWTNYQ 316 +QS +K+ G+V + I CW +Q Sbjct: 305 TQSSAKVMSKNGVLFFGLVNNSAIGCWNEHQ 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,788 Number of Sequences: 438 Number of extensions: 4109 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -