BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021702 (764 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16480.1 68416.m02103 mitochondrial processing peptidase alph... 54 1e-07 At1g51980.1 68414.m05863 mitochondrial processing peptidase alph... 53 2e-07 At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-conta... 28 5.9 >At3g16480.1 68416.m02103 mitochondrial processing peptidase alpha subunit, putative similar to mitochondrial processing peptidase alpha subunit, mitochondrial precursor, Alpha-MPP (Ubiquinol-cytochrome C reductase subunit II) [Potato] SWISS-PROT:P29677 Length = 499 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/76 (35%), Positives = 44/76 (57%) Frame = +3 Query: 273 GLSHVLRSAAGLTTKNISSFLIQRKLSQIGAYVSASGDRELIYYTLEATQDKLNDALEIL 452 G +H+L A +T N S F + R++ IG SAS RE + YT++A + + + +E+L Sbjct: 114 GATHLLERMAFKSTLNRSHFRLVREIEAIGGNTSASASREQMGYTIDALKTYVPEMVEVL 173 Query: 453 NNLVSNQEFRPWELND 500 + V N F WE+N+ Sbjct: 174 IDSVRNPAFLDWEVNE 189 >At1g51980.1 68414.m05863 mitochondrial processing peptidase alpha subunit, putative similar to mitochondrial processing peptidase alpha subunit, mitochondrial precursor, Alpha-MPP (Ubiquinol-cytochrome C reductase subunit II) [Potato] SWISS-PROT:P29677 Length = 503 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = +3 Query: 273 GLSHVLRSAAGLTTKNISSFLIQRKLSQIGAYVSASGDRELIYYTLEATQDKLNDALEIL 452 G +H+L A +T N + F + R++ IG SAS RE + YT++A + + + +E+L Sbjct: 118 GATHLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVL 177 Query: 453 NNLVSNQEFRPWELND 500 + V N F WE+N+ Sbjct: 178 IDSVRNPAFLDWEVNE 193 >At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-containing protein contains similarity to S-locus protein 5 GI:6069485 from [Brassica rapa]; contains Pfam profile PF00226 DnaJ domain Length = 695 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -3 Query: 138 YCRRSLGVAPDRNMTNKGGDESFGCHFRKFLETLGSIATKAYD 10 Y ++++ V PD+NM N+ E+F + L S+ K+YD Sbjct: 430 YRKKAMLVHPDKNMGNERAAEAFKKLQNAYEVLLDSVKQKSYD 472 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,247,634 Number of Sequences: 28952 Number of extensions: 334544 Number of successful extensions: 802 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -