BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021701 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_40708| Best HMM Match : SRCR (HMM E-Value=0) 30 2.3 SB_32385| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_30386| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) 30 2.3 SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) 29 3.0 SB_20969| Best HMM Match : DUF164 (HMM E-Value=0.6) 29 4.0 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_32940| Best HMM Match : EGF (HMM E-Value=0) 29 5.3 SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04) 29 5.3 SB_17622| Best HMM Match : zf-CCHC (HMM E-Value=0.3) 28 7.0 SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_51937| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 28 9.2 SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) 28 9.2 SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) 28 9.2 SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38) 28 9.2 SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) 28 9.2 SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 28 9.2 SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_155| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 28 9.2 SB_46071| Best HMM Match : RVP (HMM E-Value=3e-05) 28 9.2 SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) 28 9.2 SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) 28 9.2 SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 28 9.2 SB_23675| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 28 9.2 SB_19158| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 28 9.2 SB_15324| Best HMM Match : RVP (HMM E-Value=8.1e-05) 28 9.2 SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) 28 9.2 >SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 713 QSPLIQCTRCLAFGHGRKFCTESVDRCSHCGGP-HLREKCAD 591 +SP C RC GH + CT+ +C CG H+R C + Sbjct: 117 ESPGESCYRCGKSGHFARDCTDDT-KCYKCGNTGHIRRDCPE 157 >SB_40708| Best HMM Match : SRCR (HMM E-Value=0) Length = 1976 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -1 Query: 692 TRCLAFGHGRKFCTESVDRCSHCGGPHLR--EKC-ADFIAGTEP 570 T+CL C ES +C+ C P+ R KC AD AG +P Sbjct: 585 TKCLKCDSNCAICEESSTKCTSCQPPNFRLGNKCQADCGAGYKP 628 >SB_32385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1322 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 701 IQCTRCLAFGHGRKFCTESVDRCSHCGGPHLREKC 597 ++C C GH R C RC CGG H + C Sbjct: 526 LRCFNCSESGHTRAACYMD-QRCMLCGGSHEVDDC 559 >SB_30386| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) Length = 90 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 701 IQCTRCLAFGHGRKFCTESVDRCSHCGGPHLREKC 597 ++C C GH R C RC CGG H + C Sbjct: 18 LRCFNCSESGHTRAACYMD-QRCMLCGGSHEVDDC 51 >SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) Length = 832 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 695 CTRCLAFGHGRKFCTESVDRCSHCGGPHLREKC 597 C CL+ H CT RC CGG H C Sbjct: 103 CYNCLSSSHISSKCTSKF-RCRQCGGKHHTTIC 134 >SB_20969| Best HMM Match : DUF164 (HMM E-Value=0.6) Length = 478 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -1 Query: 713 QSPLIQCTRC--LAFGHGRKFCTE-SVDRCSHCGGPHLREKCADFIAGTEPQCCNC 555 QS L +C+RC L+ G G T+ S+ RCS C + I G+ +C C Sbjct: 410 QSSLARCSRCLLLSIGSGGMVLTQSSLARCSRCLLLSIGSGGMLLIQGSLARCSRC 465 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = -1 Query: 713 QSPLIQCTRC--LAFGHGRKFCTE-SVDRCSHC 624 QS L +C+RC L+ G G T+ S+ RCS C Sbjct: 387 QSSLARCSRCLLLSIGSGSMVLTQSSLARCSRC 419 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = -1 Query: 713 QSPLIQCTRC--LAFGHGRKFCTE-SVDRCSHC 624 QS L +C+RC L+ G G T+ S+ RCS C Sbjct: 341 QSSLARCSRCLVLSLGSGGMVLTQSSLARCSRC 373 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = -1 Query: 713 QSPLIQCTRC--LAFGHGRKFCTE-SVDRCSHC 624 QS L +C+RC L+ G G T+ S+ RCS C Sbjct: 364 QSSLARCSRCLVLSIGSGGMVLTQSSLARCSRC 396 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -1 Query: 713 QSPLIQCTRC--LAFGHGRKFCTE-SVDRCSHC 624 QS L C+RC L+ G G T+ S+ RCS C Sbjct: 318 QSSLAHCSRCLVLSLGSGGMVLTQSSLARCSRC 350 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 674 GHGRKFCTESVDRCSHCGGPH-LREKCAD 591 GH +K C S + CG P+ L+EKC + Sbjct: 42 GHCKKTCNTSCTTSNDCGSPNSLQEKCCN 70 >SB_32940| Best HMM Match : EGF (HMM E-Value=0) Length = 1025 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/63 (26%), Positives = 25/63 (39%) Frame = +1 Query: 457 ICCVSASQVIPLFSYRASALKALWSAFRNPECEQLQHCGSVPAMKSAHFSRRCGPPQ*LH 636 + C + Q + FS + K FR CE+ HC S P A + G P+ + Sbjct: 325 VYCSNHGQCVTNFSMSSYQCKCC-GGFRGEFCEKEDHCFSKPCKNGATCKNKEGDPRHFY 383 Query: 637 LST 645 T Sbjct: 384 TCT 386 >SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04) Length = 1223 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/66 (27%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = -1 Query: 611 LREKCADFIAGTE-----PQCCNCSHSGLRKADHNAFSADARYEKSGITWLALTQHMHNL 447 L KC ++ GT PQCC +H R+EK T+H H L Sbjct: 259 LNPKCHEYCHGTPAVCYCPQCCAVFCESCYNLEHQGNERKRRHEKQSKLRPICTEHRHPL 318 Query: 446 NAGHYT 429 +T Sbjct: 319 EFFDFT 324 >SB_17622| Best HMM Match : zf-CCHC (HMM E-Value=0.3) Length = 374 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 635 CSHCGGPHLREKCADFIAGTEPQC--CNCSHSGLRKADHNA 519 C C G H R+ C + T P+C CN +H L D +A Sbjct: 148 CFKCTGKHFRKDCEE----TPPRCEACNKNHLTLLHEDRSA 184 >SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1577 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = -1 Query: 698 QCTRCLAFGHGRKFCTESVDRCSHCGGPHLREKCADFIAG 579 +C RCL H C C C G H C + +G Sbjct: 357 RCFRCLRKNHRSYECKSKDSNCKGCAGAHHLSICENQASG 396 >SB_51937| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 151 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 105 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 142 >SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) Length = 1311 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 105 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 142 >SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) Length = 1510 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 207 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 244 >SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38) Length = 856 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 350 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 387 >SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) Length = 1425 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 876 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 913 >SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 794 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 342 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 379 >SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 422 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKMGHLKRVC 459 >SB_155| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 296 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 207 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 244 >SB_46071| Best HMM Match : RVP (HMM E-Value=3e-05) Length = 403 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 207 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 244 >SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) Length = 1122 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 223 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 260 >SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 919 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = -1 Query: 548 SGLRKADHNAFSADARYEKSGITWLALTQHMHNLNAGHYTARTHRHKAHRNKN 390 S L+ + FS + G+ + ++H + + H+ HRH HR+ + Sbjct: 401 SPLKHSTSGPFSPPRHHGHGGLEAIQTSKHQQDQHHHHHHHHHHRHHKHRSSS 453 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 493 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 530 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 546 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 583 >SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 1750 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 185 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 222 >SB_23675| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 342 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 180 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 217 >SB_19158| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 369 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 207 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 244 >SB_15324| Best HMM Match : RVP (HMM E-Value=8.1e-05) Length = 415 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 44 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 81 >SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) Length = 717 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 707 PLIQCTRCLAFGHGRKFCTESVDRCSHCGG-PHLREKC 597 P C RC + H K C +C +CG HL+ C Sbjct: 246 PKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVC 283 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,104,352 Number of Sequences: 59808 Number of extensions: 344274 Number of successful extensions: 1049 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -