BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021695 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/23 (43%), Positives = 19/23 (82%) Frame = +1 Query: 19 EDEKPNDEKQNEPQANSKKDEGE 87 E+EK N+E++NE + + +++EGE Sbjct: 70 EEEKENEEEENEDEEDEEEEEGE 92 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 4 KGDNIEDEKPNDEKQNEPQANSKKDEGEQ 90 K D IE E+ +EK+NE + N +++ E+ Sbjct: 60 KEDEIEVEEEEEEKENEEEENEDEEDEEE 88 >SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 294 EHSFELFVFAELFNEMLMRDFGFYIYKTLYTLPEKT 401 E ++F+FA+ FN + + ++ T YT+ EKT Sbjct: 182 ESILDVFMFAKAFNSQYLTMWCLHVIATNYTIFEKT 217 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,259,551 Number of Sequences: 59808 Number of extensions: 185361 Number of successful extensions: 722 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -