BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021693 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 29 0.20 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 27 0.79 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 1.8 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 25 3.2 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 25 3.2 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 25 3.2 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 25 3.2 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 4.2 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 4.2 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 4.2 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 4.2 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 24 5.6 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 24 5.6 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 7.4 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 23 7.4 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 7.4 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 28.7 bits (61), Expect = 0.20 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 286 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASHPSDHSLIYR 441 D L R S SS S++ +T V P P+ + Q + D SL+YR Sbjct: 866 DSLSRNVSQASSTSDLSKTISVAPDPIDINAKLITETGQRSLKRGDPSLLYR 917 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 26.6 bits (56), Expect = 0.79 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 326 AMWGALEMYCPHHCQMWKLVP 388 A+W L+ PH CQM +L+P Sbjct: 20 ALWLFLKFEVPHCCQMEELIP 40 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 193 DWHNYPGIMAPVPAPSGTRSLAAIVRD 273 +W + PGI P A S R+ A +V D Sbjct: 1158 EWRHVPGIHNPADAVSRGRNPAEVVED 1184 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.2 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 83 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 211 L TL H K F P L S G WL F + V TII+ Sbjct: 77 LNCTLYH--PKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM 117 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.2 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 83 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 211 L TL H K F P L S G WL F + V TII+ Sbjct: 77 LNCTLYH--PKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM 117 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.2 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 83 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 211 L TL H K F P L S G WL F + V TII+ Sbjct: 77 LNCTLYH--PKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM 117 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 24.6 bits (51), Expect = 3.2 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 83 LELTLEHFTTKAMLRFHPKLGSERGSEWLCCFCLHVRTGTIIL 211 L TL H K F P L S G WL F + V TII+ Sbjct: 111 LNCTLYH--PKQREEFSPVLQSMSGVFWLMIFLMFVAIFTIIM 151 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 223 PVPAPSGTRSLAAIVRDPRLLDELDRESSPVSSWSNVGRTGDVLPTP 363 P + G A ++ R ++E R+S+P +S + + R+ PTP Sbjct: 1422 PGGSGGGHTGPAGLISRWRDMEEGGRQSTPPASPARLARSSPASPTP 1468 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 286 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASH 414 DE D + WSN +TG+ P S+ ++ H H Sbjct: 621 DEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRH 663 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 286 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASH 414 DE D + WSN +TG+ P S+ ++ H H Sbjct: 621 DEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRH 663 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 286 DELDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASH 414 DE D + WSN +TG+ P S+ ++ H H Sbjct: 507 DEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRH 549 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 391 PYSQHASHPSDH-SLIYRKY 447 PY QH HP+ H +L++ Y Sbjct: 173 PYPQHVLHPAHHPALLHPAY 192 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 391 PYSQHASHPSDH-SLIYRKY 447 PY QH HP+ H +L++ Y Sbjct: 173 PYPQHVLHPAHHPALLHPAY 192 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 7.4 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 Query: 208 PGIMAPVPAPSGTRSLAAIVRDPRLLDELDRESSPVSSWSNVGR 339 P + AP+P PS SL P L +LD +S S + R Sbjct: 350 PVVTAPLPGPSPPSSLGMPGNIPN-LSQLDATGGQSASTSGLPR 392 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 23.4 bits (48), Expect = 7.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 147 LPNLGWNLNIALVVKCSRVSSRICTDYISTE 55 L NLGWNLN IC Y+ TE Sbjct: 426 LSNLGWNLNSLQFPS----GIHICVTYMHTE 452 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 256 AAIVRDPRLLDELDR 300 AAI+RDP+L E DR Sbjct: 431 AAIMRDPQLFPEPDR 445 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 792,919 Number of Sequences: 2352 Number of extensions: 16877 Number of successful extensions: 31 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -