BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021693 (734 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC038117-1|AAH38117.1| 317|Homo sapiens LAPTM4B protein protein. 44 4e-04 BC031021-1|AAH31021.1| 226|Homo sapiens LAPTM4B protein protein. 44 4e-04 BC014129-1|AAH14129.1| 226|Homo sapiens LAPTM4B protein protein. 44 4e-04 AY261384-1|AAO84265.1| 370|Homo sapiens lysosome-associated tra... 44 4e-04 AY057051-1|AAL17908.2| 317|Homo sapiens lysosomal associated tr... 44 4e-04 AK075326-1|BAC11549.1| 226|Homo sapiens protein ( Homo sapiens ... 44 4e-04 AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane trans... 44 4e-04 AF527412-1|AAP14034.1| 317|Homo sapiens lysosomal associated tr... 44 4e-04 AF317417-1|AAK69595.1| 226|Homo sapiens lysosomal-associated tr... 44 4e-04 D14696-1|BAA03522.2| 254|Homo sapiens KIAA0108 protein. 44 8e-04 CR456758-1|CAG33039.1| 233|Homo sapiens LAPTM4A protein. 44 8e-04 BC093075-1|AAH93075.1| 233|Homo sapiens lysosomal-associated pr... 44 8e-04 BC003158-1|AAH03158.1| 233|Homo sapiens lysosomal-associated pr... 44 8e-04 BC000421-1|AAH00421.1| 233|Homo sapiens lysosomal-associated pr... 44 8e-04 AY359028-1|AAQ89387.1| 215|Homo sapiens MTP protein. 44 8e-04 AC098828-1|AAY24172.1| 38|Homo sapiens unknown protein. 41 0.004 AY219177-1|AAO64359.1| 124|Homo sapiens lysosome-associated pro... 40 0.007 AY219176-1|AAO64358.1| 124|Homo sapiens lysosome-associated pro... 40 0.007 AY198226-1|AAO63563.1| 124|Homo sapiens LAPTM4B protein. 40 0.007 AY679523-1|AAT74623.1| 1512|Homo sapiens cell division cycle 2-l... 31 3.2 AJ297710-1|CAC10401.1| 1452|Homo sapiens CDC2L5 protein kinase p... 31 3.2 AJ297709-1|CAC10400.1| 1512|Homo sapiens CDC2L5 protein kinase p... 31 3.2 AC072061-1|AAS07491.1| 784|Homo sapiens unknown protein. 31 3.2 >BC038117-1|AAH38117.1| 317|Homo sapiens LAPTM4B protein protein. Length = 317 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 106 CCLCCHVRTGTILLGVWYLIINAVVL 131 >BC031021-1|AAH31021.1| 226|Homo sapiens LAPTM4B protein protein. Length = 226 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 15 CCLCCHVRTGTILLGVWYLIINAVVL 40 >BC014129-1|AAH14129.1| 226|Homo sapiens LAPTM4B protein protein. Length = 226 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 15 CCLCCHVRTGTILLGVWYLIINAVVL 40 >AY261384-1|AAO84265.1| 370|Homo sapiens lysosome-associated transmembrane protein 4 beta protein. Length = 370 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 159 CCLCCHVRTGTILLGVWYLIINAVVL 184 >AY057051-1|AAL17908.2| 317|Homo sapiens lysosomal associated transmembrane protein 4 beta, variant 1 protein. Length = 317 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 106 CCLCCHVRTGTILLGVWYLIINAVVL 131 >AK075326-1|BAC11549.1| 226|Homo sapiens protein ( Homo sapiens cDNA PSEC0001 fis, clone NT2RM1000066, moderately similar to Lysosomal-associated transmembrane protein 4 beta. ). Length = 226 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 15 CCLCCHVRTGTILLGVWYLIINAVVL 40 >AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane transporter protein protein. Length = 283 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 72 CCLCCHVRTGTILLGVWYLIINAVVL 97 >AF527412-1|AAP14034.1| 317|Homo sapiens lysosomal associated transmembrane protein 4 beta variant 2 protein. Length = 317 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 106 CCLCCHVRTGTILLGVWYLIINAVVL 131 >AF317417-1|AAK69595.1| 226|Homo sapiens lysosomal-associated transmembrane protein 4 beta protein. Length = 226 Score = 44.4 bits (100), Expect = 4e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHLFLHLVAL 247 CC C HVRTGTI+LG W+L ++ V L Sbjct: 15 CCLCCHVRTGTILLGVWYLIINAVVL 40 >D14696-1|BAA03522.2| 254|Homo sapiens KIAA0108 protein. Length = 254 Score = 43.6 bits (98), Expect = 8e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 146 SERGSEWLCCFCLHVRTGTIILGSWHLFLHLV 241 S+R CC C HVRTGTIILG+W++ ++L+ Sbjct: 32 SDRFYSTRCCGCCHVRTGTIILGTWYMVVNLL 63 >CR456758-1|CAG33039.1| 233|Homo sapiens LAPTM4A protein. Length = 233 Score = 43.6 bits (98), Expect = 8e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 146 SERGSEWLCCFCLHVRTGTIILGSWHLFLHLV 241 S+R CC C HVRTGTIILG+W++ ++L+ Sbjct: 11 SDRFYSTRCCGCCHVRTGTIILGTWYMVVNLL 42 >BC093075-1|AAH93075.1| 233|Homo sapiens lysosomal-associated protein transmembrane 4 alpha protein. Length = 233 Score = 43.6 bits (98), Expect = 8e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 146 SERGSEWLCCFCLHVRTGTIILGSWHLFLHLV 241 S+R CC C HVRTGTIILG+W++ ++L+ Sbjct: 11 SDRFYSTRCCGCCHVRTGTIILGTWYMVVNLL 42 >BC003158-1|AAH03158.1| 233|Homo sapiens lysosomal-associated protein transmembrane 4 alpha protein. Length = 233 Score = 43.6 bits (98), Expect = 8e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 146 SERGSEWLCCFCLHVRTGTIILGSWHLFLHLV 241 S+R CC C HVRTGTIILG+W++ ++L+ Sbjct: 11 SDRFYSTRCCGCCHVRTGTIILGTWYMVVNLL 42 >BC000421-1|AAH00421.1| 233|Homo sapiens lysosomal-associated protein transmembrane 4 alpha protein. Length = 233 Score = 43.6 bits (98), Expect = 8e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 146 SERGSEWLCCFCLHVRTGTIILGSWHLFLHLV 241 S+R CC C HVRTGTIILG+W++ ++L+ Sbjct: 11 SDRFYSTRCCGCCHVRTGTIILGTWYMVVNLL 42 >AY359028-1|AAQ89387.1| 215|Homo sapiens MTP protein. Length = 215 Score = 43.6 bits (98), Expect = 8e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 146 SERGSEWLCCFCLHVRTGTIILGSWHLFLHLV 241 S+R CC C HVRTGTIILG+W++ ++L+ Sbjct: 11 SDRFYSTRCCGCCHVRTGTIILGTWYMVVNLL 42 >AC098828-1|AAY24172.1| 38|Homo sapiens unknown protein. Length = 38 Score = 41.1 bits (92), Expect = 0.004 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +2 Query: 146 SERGSEWLCCFCLHVRTGTIILGSWHL 226 S+R CC C HVRTGTIILG+W++ Sbjct: 11 SDRFYSTRCCGCCHVRTGTIILGTWYM 37 >AY219177-1|AAO64359.1| 124|Homo sapiens lysosome-associated protein transmembrane 4 beta protein. Length = 124 Score = 40.3 bits (90), Expect = 0.007 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHL 226 CC C HVRTGTI+LG W+L Sbjct: 106 CCLCCHVRTGTILLGVWYL 124 >AY219176-1|AAO64358.1| 124|Homo sapiens lysosome-associated protein transmembrane 4 beta protein. Length = 124 Score = 40.3 bits (90), Expect = 0.007 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHL 226 CC C HVRTGTI+LG W+L Sbjct: 106 CCLCCHVRTGTILLGVWYL 124 >AY198226-1|AAO63563.1| 124|Homo sapiens LAPTM4B protein. Length = 124 Score = 40.3 bits (90), Expect = 0.007 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +2 Query: 170 CCFCLHVRTGTIILGSWHL 226 CC C HVRTGTI+LG W+L Sbjct: 106 CCLCCHVRTGTILLGVWYL 124 >AY679523-1|AAT74623.1| 1512|Homo sapiens cell division cycle 2-like 5 (cholinesterase-related cell division controller) protein. Length = 1512 Score = 31.5 bits (68), Expect = 3.2 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 229 PAPSGTRSLAAIVRDPRLLDELDRESSP-VSSWSNVGRTGDVLPTPLSNVETR--PSPYS 399 P+P+G S R PR R SP S S+ R GDV P+P S+ R SPYS Sbjct: 341 PSPAGGGSSPYSRRLPRSPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYS 400 >AJ297710-1|CAC10401.1| 1452|Homo sapiens CDC2L5 protein kinase protein. Length = 1452 Score = 31.5 bits (68), Expect = 3.2 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 229 PAPSGTRSLAAIVRDPRLLDELDRESSP-VSSWSNVGRTGDVLPTPLSNVETR--PSPYS 399 P+P+G S R PR R SP S S+ R GDV P+P S+ R SPYS Sbjct: 341 PSPAGGGSSPYSRRLPRSPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYS 400 >AJ297709-1|CAC10400.1| 1512|Homo sapiens CDC2L5 protein kinase protein. Length = 1512 Score = 31.5 bits (68), Expect = 3.2 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 229 PAPSGTRSLAAIVRDPRLLDELDRESSP-VSSWSNVGRTGDVLPTPLSNVETR--PSPYS 399 P+P+G S R PR R SP S S+ R GDV P+P S+ R SPYS Sbjct: 341 PSPAGGGSSPYSRRLPRSPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYS 400 >AC072061-1|AAS07491.1| 784|Homo sapiens unknown protein. Length = 784 Score = 31.5 bits (68), Expect = 3.2 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 229 PAPSGTRSLAAIVRDPRLLDELDRESSP-VSSWSNVGRTGDVLPTPLSNVETR--PSPYS 399 P+P+G S R PR R SP S S+ R GDV P+P S+ R SPYS Sbjct: 341 PSPAGGGSSPYSRRLPRSPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYS 400 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,669,864 Number of Sequences: 237096 Number of extensions: 2509969 Number of successful extensions: 5992 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 5586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5992 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -