BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021691 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55410.1 68416.m06154 2-oxoglutarate dehydrogenase E1 compone... 138 2e-33 At5g65750.1 68418.m08274 2-oxoglutarate dehydrogenase E1 compone... 134 6e-32 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 33 0.22 At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing prote... 29 2.0 At5g44635.1 68418.m05469 minichromosome maintenance family prote... 29 3.5 At4g22030.1 68417.m03187 F-box family protein PF0064: F-box doma... 28 6.2 At5g28237.2 68418.m03423 tryptophan synthase, beta subunit, puta... 27 8.2 At5g28237.1 68418.m03422 tryptophan synthase, beta subunit, puta... 27 8.2 At3g50210.2 68416.m05490 2-oxoacid-dependent oxidase, putative s... 27 8.2 At3g50210.1 68416.m05491 2-oxoacid-dependent oxidase, putative s... 27 8.2 At3g24120.2 68416.m03029 myb family transcription factor contain... 27 8.2 At3g24120.1 68416.m03028 myb family transcription factor contain... 27 8.2 At1g76520.2 68414.m08905 auxin efflux carrier family protein con... 27 8.2 At1g76520.1 68414.m08904 auxin efflux carrier family protein con... 27 8.2 >At3g55410.1 68416.m06154 2-oxoglutarate dehydrogenase E1 component, putative / oxoglutarate decarboxylase, putative / alpha-ketoglutaric dehydrogenase, putative similar to SP|P20967 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) {Saccharomyces cerevisiae}; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF00676: Dehydrogenase E1 component Length = 1017 Score = 138 bits (335), Expect = 2e-33 Identities = 60/84 (71%), Positives = 69/84 (82%) Frame = +2 Query: 257 LPAYTTHGTIHIVANNQIGFTTDPRHSRSSAYCTDVARVVNAPIFHVNGDNPEAVMHVCN 436 LP YTT GTIHIV NNQ+ FTTDPR RSS YCTDVA+ ++APIFHVNGD+ EAV+H C Sbjct: 417 LPNYTTGGTIHIVVNNQVAFTTDPRAGRSSQYCTDVAKALSAPIFHVNGDDVEAVVHACE 476 Query: 437 VAAEWRATFHKDVVIDIVSYRRNG 508 +AAEWR TFH DVV+D+V YRR G Sbjct: 477 LAAEWRQTFHSDVVVDLVCYRRFG 500 Score = 106 bits (255), Expect = 1e-23 Identities = 51/84 (60%), Positives = 63/84 (75%) Frame = +3 Query: 3 SGDVKYHLGTYIERLNRVTNKNIRLAVCANPSHLEAVDPVVQGKTRAEQFYRGDNEGKKV 182 +GDVKYHLGT +R R K I L++ ANPSHLEA D VV GKTRA+Q+Y D + K Sbjct: 333 TGDVKYHLGTSYDRPTR-GGKKIHLSLVANPSHLEAADSVVVGKTRAKQYYSNDLDRTKN 391 Query: 183 MSILLHGDAAFAGQGVVFETMHLS 254 + IL+HGD +FAGQGVV+ET+HLS Sbjct: 392 LGILIHGDGSFAGQGVVYETLHLS 415 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/48 (35%), Positives = 31/48 (64%) Frame = +1 Query: 508 NNEVDEPMFTQPLMYQKIRKTKPVLEKYADQLIAEGVVTAEEVKDVKD 651 +NE+DEP FTQP MY+ I+ L+ Y +L+ G V+ +++ +++ Sbjct: 501 HNEIDEPSFTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQE 548 >At5g65750.1 68418.m08274 2-oxoglutarate dehydrogenase E1 component, putative / oxoglutarate decarboxylase, putative / alpha-ketoglutaric dehydrogenase, putative similar to SP|P20967 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) {Saccharomyces cerevisiae}; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF00676: Dehydrogenase E1 component Length = 1025 Score = 134 bits (323), Expect = 6e-32 Identities = 57/84 (67%), Positives = 67/84 (79%) Frame = +2 Query: 257 LPAYTTHGTIHIVANNQIGFTTDPRHSRSSAYCTDVARVVNAPIFHVNGDNPEAVMHVCN 436 LP Y T GT+HIV NNQ+ FTTDPR RSS YCTDVA+ ++APIFHVN D+ EAV+H C Sbjct: 421 LPNYCTGGTVHIVVNNQVAFTTDPREGRSSQYCTDVAKALSAPIFHVNADDIEAVVHACE 480 Query: 437 VAAEWRATFHKDVVIDIVSYRRNG 508 +AAEWR TFH DVV+D+V YRR G Sbjct: 481 LAAEWRQTFHSDVVVDLVCYRRFG 504 Score = 111 bits (267), Expect = 4e-25 Identities = 53/84 (63%), Positives = 65/84 (77%) Frame = +3 Query: 3 SGDVKYHLGTYIERLNRVTNKNIRLAVCANPSHLEAVDPVVQGKTRAEQFYRGDNEGKKV 182 +GDVKYHLGT +R R K++ L++ ANPSHLEAVDPVV GKTRA+Q+Y D K Sbjct: 337 TGDVKYHLGTSYDRPTR-GGKHLHLSLVANPSHLEAVDPVVIGKTRAKQYYTKDENRTKN 395 Query: 183 MSILLHGDAAFAGQGVVFETMHLS 254 M IL+HGD +FAGQGVV+ET+HLS Sbjct: 396 MGILIHGDGSFAGQGVVYETLHLS 419 Score = 47.6 bits (108), Expect = 7e-06 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +1 Query: 508 NNEVDEPMFTQPLMYQKIRKTKPVLEKYADQLIAEGVVTAEEVKDVK 648 +NE+DEP FTQP MY+ IR L+ Y ++L+ G VT E++ ++ Sbjct: 505 HNEIDEPSFTQPKMYKVIRSHPSSLQIYQEKLLQSGQVTQEDIDKIQ 551 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 32.7 bits (71), Expect = 0.22 Identities = 25/82 (30%), Positives = 33/82 (40%) Frame = +1 Query: 277 RDHTHRRQQPDRVHDRPQALQIFRLLHRRGPRCKRSDIPRERRQSRGRDARL*RGCRMES 456 R H R R HDR A ++ R R R R D +RR+ R R+ + R E Sbjct: 416 RQHRDERDDGRRQHDREDARELERKHRERKERESRED--EDRRRRRRREESRDKESRRER 473 Query: 457 HVPQGRCH*HRQLQEKRNNEVD 522 R HR +E+R D Sbjct: 474 DEDDHRS--HRDYKERRRERDD 493 >At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: LUC7 N_terminus Length = 402 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +1 Query: 271 HARDHTHRRQQPDRVHDRPQALQIFRLLHRRGPRCKRSDIPRERRQSRGRD 423 H RD+ R + DR HDR + R R R +R R R + R RD Sbjct: 344 HRRDYDRRSRDRDRHHDRDREQD--RDYDRSHSRSRRRSRSRSRSRDRPRD 392 >At5g44635.1 68418.m05469 minichromosome maintenance family protein / MCM family protein similar to SP|P97311 DNA replication licensing factor MCM6 {Mus musculus}; contains Pfam profile PF00493: MCM2/3/5 family Length = 831 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -2 Query: 140 SGLALHHGVDGLQVRGVRANSQSNVLVGNAIQTLD 36 S A H GV GL+ GVR S + N++Q D Sbjct: 272 SSTAGHEGVQGLKALGVRDLSYRLAFIANSVQIAD 306 >At4g22030.1 68417.m03187 F-box family protein PF0064: F-box domain; similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana] Length = 626 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 52 ALPTRTLDWLFARTPRTWRPSTPWCRARPEPSSSTGE 162 A P + + + P+ ++P+T W +PEP+ S E Sbjct: 221 AYPLPLVGTMLEKFPQEFKPATWWPETKPEPTHSRTE 257 >At5g28237.2 68418.m03423 tryptophan synthase, beta subunit, putative similar to SP|P14671 Tryptophan synthase beta chain 1, chloroplast precursor (EC 4.2.1.20) {Arabidopsis thaliana}; contains Pfam profile PF00291: Pyridoxal-phosphate dependent enzyme Length = 372 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 639 FNLLSCDDSFRDQLVRVFLQYWFGLTNLLVHEGLSEH 529 FN + CD F+++L Y T L E L+EH Sbjct: 95 FNFVRCDHEFQEELTTALRDYVGRETPLYFAERLTEH 131 >At5g28237.1 68418.m03422 tryptophan synthase, beta subunit, putative similar to SP|P14671 Tryptophan synthase beta chain 1, chloroplast precursor (EC 4.2.1.20) {Arabidopsis thaliana}; contains Pfam profile PF00291: Pyridoxal-phosphate dependent enzyme Length = 465 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 639 FNLLSCDDSFRDQLVRVFLQYWFGLTNLLVHEGLSEH 529 FN + CD F+++L Y T L E L+EH Sbjct: 95 FNFVRCDHEFQEELTTALRDYVGRETPLYFAERLTEH 131 >At3g50210.2 68416.m05490 2-oxoacid-dependent oxidase, putative strong similarity to partial cds of 2-oxoacid-dependent oxidase (din11) from GI:10834554 [Arabidopsis thaliana] Length = 250 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +3 Query: 27 GTYIERLNRVTNKNIRLAVCANPSHLEAVDPVVQGKTRAEQFYRGDNEGKKVMSILLHGD 206 G Y L+RV N + + VC + D VV+ +Q Y G G +V ++G+ Sbjct: 179 GVYESTLHRVINNSPQYRVCVAFFYETNFDAVVEPLDICKQKYPGGRGGCQVFKRAVYGE 238 >At3g50210.1 68416.m05491 2-oxoacid-dependent oxidase, putative strong similarity to partial cds of 2-oxoacid-dependent oxidase (din11) from GI:10834554 [Arabidopsis thaliana] Length = 332 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +3 Query: 27 GTYIERLNRVTNKNIRLAVCANPSHLEAVDPVVQGKTRAEQFYRGDNEGKKVMSILLHGD 206 G Y L+RV N + + VC + D VV+ +Q Y G G +V ++G+ Sbjct: 261 GVYESTLHRVINNSPQYRVCVAFFYETNFDAVVEPLDICKQKYPGGRGGCQVFKRAVYGE 320 >At3g24120.2 68416.m03029 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 298 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 301 VGDDVYGPVRGVGGQVDRCIVSNTTP*P 218 VG D +GP+ G D C+V T P P Sbjct: 15 VGGDYHGPLDGTNLPGDACLVLTTDPKP 42 >At3g24120.1 68416.m03028 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 295 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 301 VGDDVYGPVRGVGGQVDRCIVSNTTP*P 218 VG D +GP+ G D C+V T P P Sbjct: 15 VGGDYHGPLDGTNLPGDACLVLTTDPKP 42 >At1g76520.2 68414.m08905 auxin efflux carrier family protein contains auxin efflux carrier domain, Pfam:PF03547 Length = 390 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 472 VLVERGSPFGSHVTNVHHGLGIVAVHVEYRSVY 374 V E+G PFG + +G+G VA+ + S+Y Sbjct: 128 VCKEKGGPFGDPESCQKYGMGYVALSMAMGSIY 160 >At1g76520.1 68414.m08904 auxin efflux carrier family protein contains auxin efflux carrier domain, Pfam:PF03547 Length = 390 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 472 VLVERGSPFGSHVTNVHHGLGIVAVHVEYRSVY 374 V E+G PFG + +G+G VA+ + S+Y Sbjct: 128 VCKEKGGPFGDPESCQKYGMGYVALSMAMGSIY 160 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,022,251 Number of Sequences: 28952 Number of extensions: 286141 Number of successful extensions: 894 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -