Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021687
         (778 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    24   1.2  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      22   6.3  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      22   6.3  

>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +3

Query: 609 YRFSEVNRLLADPTFDPKRPTVLFAHGYVE 698
           +RF E   ++ADP  D + P     H Y++
Sbjct: 378 HRFLEPFGVMADPAVDLRDPLFFRWHAYID 407


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +2

Query: 71  PRDQLTWR 94
           PR+QLTWR
Sbjct: 592 PREQLTWR 599


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +2

Query: 71  PRDQLTWR 94
           PR+QLTWR
Sbjct: 484 PREQLTWR 491


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,528
Number of Sequences: 336
Number of extensions: 3601
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20961338
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)