BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021687 (778 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK025518-1|BAB15158.1| 377|Homo sapiens protein ( Homo sapiens ... 34 0.66 AF512564-1|AAM80487.1| 743|Homo sapiens endo-beta-N-acetylgluco... 34 0.66 >AK025518-1|BAB15158.1| 377|Homo sapiens protein ( Homo sapiens cDNA: FLJ21865 fis, clone HEP02351. ). Length = 377 Score = 33.9 bits (74), Expect = 0.66 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 546 SFTPNDIILRYYGKNSTVPTSYRFSEVNRLLA 641 SF+P+ + +RYY K++T P S+ S + LLA Sbjct: 64 SFSPDPLPVRYYDKDTTKPISFYLSSLEELLA 95 >AF512564-1|AAM80487.1| 743|Homo sapiens endo-beta-N-acetylglucosaminidase protein. Length = 743 Score = 33.9 bits (74), Expect = 0.66 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 546 SFTPNDIILRYYGKNSTVPTSYRFSEVNRLLA 641 SF+P+ + +RYY K++T P S+ S + LLA Sbjct: 64 SFSPDPLPVRYYDKDTTKPISFYLSSLEELLA 95 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,983,267 Number of Sequences: 237096 Number of extensions: 2098714 Number of successful extensions: 2861 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2860 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9423020542 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -