BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021684 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 27 0.59 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 4.1 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 27.1 bits (57), Expect = 0.59 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 364 KVLNMFSTSAATTYFGSSMV-MYAPTMDIDTVDIAVAAMVYIRLREI 501 K++ SA FGS +Y PT DID V I M+ +R E+ Sbjct: 301 KIVQNLWPSARVEMFGSFRTGLYLPTSDIDLVVIGQWTMLPLRTLEM 347 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 173 CLPPLLAGLATASPSRASWATSSIRLHG*WVFL 75 C P L AT +P+ ++W + S+ ++FL Sbjct: 85 CTPVLSRQRATRAPTTSTWTSKSVLCEELFLFL 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 821,152 Number of Sequences: 2352 Number of extensions: 17859 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -