BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021684 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.55 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 8.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.4 bits (53), Expect = 0.55 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +3 Query: 552 RELTALKDSSLPMPLTLESRKPIARMITDNAFSCGRNTLPLVASCPPSS 698 R+ + KDSS L L+ P A+SCG ++P PPSS Sbjct: 1249 RQRSLFKDSSPATALMLQHAPP--------AYSCGTVSVPQQQQLPPSS 1289 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = +1 Query: 112 VAQDALEGDAVAKPASNGGKQCVQRGDQ 195 +AQD+ E ++ P+++GG+ +R ++ Sbjct: 1344 LAQDSSEDESYRGPSASGGRPVPERPER 1371 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 83 VFLPVKHCKW 54 +F+PVK C W Sbjct: 228 IFVPVKPCPW 237 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 366 GAEHVQYQRSNDVF 407 GA +VQYQ D+F Sbjct: 290 GANNVQYQGVQDIF 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,386 Number of Sequences: 438 Number of extensions: 4665 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -