BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021682 (730 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0310 + 29135875-29136052,29136206-29136617,29136723-291368... 31 1.2 11_06_0197 + 21149453-21149630,21149930-21149996,21150142-211502... 30 2.2 12_01_1059 - 10934937-10935446,10938224-10938271,10938383-109386... 29 2.9 10_08_0426 - 17817975-17818582,17819068-17819209,17819648-178197... 29 3.8 03_03_0114 - 14554964-14555136,14556317-14556474,14557413-145574... 28 6.6 03_06_0054 + 31313348-31313560,31313662-31313856,31313933-313140... 28 8.7 >05_07_0310 + 29135875-29136052,29136206-29136617,29136723-29136867, 29137944-29138102,29138183-29138242,29138349-29138546 Length = 383 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +3 Query: 39 SAANAKSEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQK--AGKELNSDQ 212 S + E P + E++ P + MT+ E++ EKRK+ L + +K KEL + Q Sbjct: 224 SEVDKDKESPENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALKAEERKVEVDKELQAMQ 283 Query: 213 KVAVAKYDE 239 +++V K +E Sbjct: 284 QLSVKKANE 292 >11_06_0197 + 21149453-21149630,21149930-21149996,21150142-21150244, 21150901-21150971,21151091-21151154,21151239-21151304, 21151416-21151463,21151544-21151606,21151680-21151736, 21151884-21151950,21151969-21152042,21152176-21152244, 21152323-21152414,21152782-21152860,21153233-21153398, 21153826-21153950,21154089-21154351,21154473-21154569, 21154659-21154820,21154904-21155008,21155935-21156180 Length = 753 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 535 EEGQSGFHLQITRAAEHLYSIIDGKPKEVLGTTYLRIKEIVSTV 666 E Q+ + EH SI++ K +E G +R+KE STV Sbjct: 512 ELDQTTIRKMVMELREHARSIVEEKAREEAGNVLMRMKERFSTV 555 >12_01_1059 - 10934937-10935446,10938224-10938271,10938383-10938619, 10938711-10938747,10941018-10941286 Length = 366 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +3 Query: 57 SEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELN 203 S K +K P R M +EH+ N+EK S+ ++K+ + ++ Sbjct: 290 SRKSTDRREKSRPTRDRMRGVEHRYSNVEKTDKLKFSFDHMEKSRRSID 338 >10_08_0426 - 17817975-17818582,17819068-17819209,17819648-17819745, 17820070-17821897,17822331-17822738,17822891-17822943, 17823461-17823877,17824401-17824605 Length = 1252 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +3 Query: 57 SEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKVAVAK 230 S + S D P+ I+T + HK R + K S+ A K+L+ D +V V + Sbjct: 475 SYRSDSQGSTDNPLYDILTKLIHKTRPAHRSKKTKISFVAKDVAIKKLSDDSEVQVVE 532 >03_03_0114 - 14554964-14555136,14556317-14556474,14557413-14557486, 14557589-14557703,14557818-14558054,14558157-14558233 Length = 277 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 54 KSEKPASSEDKDTPIRQIMTIIEHKIRNLEKRKSKLTSYRDLQKAGK 194 K SS T I ++ IE+K+RN+E+ ++ ++ + AGK Sbjct: 146 KKNSEESSTQWTTGIAEVQLPIEYKLRNIEETEAAKKMLQEKRLAGK 192 >03_06_0054 + 31313348-31313560,31313662-31313856,31313933-31314098, 31314193-31314599 Length = 326 Score = 27.9 bits (59), Expect = 8.7 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 383 LLILDCLMQMGSADARTDFINGT 451 LL++ + Q+G++D RTD+ N T Sbjct: 12 LLVVAAVAQLGASDLRTDYYNST 34 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,042,833 Number of Sequences: 37544 Number of extensions: 300379 Number of successful extensions: 702 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -