BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021680 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 51 3e-08 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 26 1.1 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 1.9 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 25 2.5 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 4.4 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 7.6 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 7.6 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 51.2 bits (117), Expect = 3e-08 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = +3 Query: 519 QTGSGKTLAYILPAIVHI-NNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 692 QTGSGKT A++LP I H+ + + + R P +++APTRELA QI F H + + Sbjct: 219 QTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKL 278 Query: 693 RNTCVFGGAPKREQ 734 + +GG + Q Sbjct: 279 KVCVSYGGTAVQHQ 292 Score = 41.9 bits (94), Expect = 2e-05 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +2 Query: 347 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G++L+A Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMA 216 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 100 TVVPNLEEATNSAIIRLDLATVAVDLEDLEDLVGKKNSLE 219 T++ +L+E S + LDL +D +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.4 bits (53), Expect = 1.9 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Frame = -1 Query: 276 FLLKGWSEQNPNL---GDACSDLQRILF----SHQILQILQIYCH 163 F+ KG E +PN GDA D++ +LF S +I +Q CH Sbjct: 926 FVEKGILEGSPNCPECGDAVEDVEHVLFHCPRSDRIRNEMQQRCH 970 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +2 Query: 455 PTPIQAQGWPIAMSGKNLLAYSNGFRQNVGLHLASHCAHKQPTAYSER 598 P P + GW ++ SG ++ +++ ++ S CA P+ R Sbjct: 49 PPPCRVPGWRLSTSGASIRMHASARKRAYCPRTRSACAETFPSTRRRR 96 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 24.2 bits (50), Expect = 4.4 Identities = 16/70 (22%), Positives = 26/70 (37%) Frame = +2 Query: 221 SEHASPRLGFCSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEE 400 SE + +++P Y+P P VL + V E + ++ + V EE Sbjct: 97 SEDVESSIPVSTIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEE 156 Query: 401 ANFPDYVQQG 430 A Y G Sbjct: 157 AQIDVYHVDG 166 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +3 Query: 510 WRTQTGSGKTLAYILPAIVHINNQPPIRRGDG 605 ++ Q + ++ I A+V + Q +RR DG Sbjct: 461 YKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.4 bits (48), Expect = 7.6 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 154 LATVAVDLEDLEDLVGKKNSLEVRTCVAQIGILFT 258 L +A+D+ L+ +GKK +L V + +G + + Sbjct: 176 LMAIAIDMNPLKPRMGKKATLCVAASIWIVGTIIS 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 757,116 Number of Sequences: 2352 Number of extensions: 15282 Number of successful extensions: 39 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -