BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021679 (673 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 111 3e-25 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 105 3e-23 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 80 1e-15 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 49 3e-06 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 48 8e-06 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 45 5e-05 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 44 9e-05 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 44 9e-05 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 43 2e-04 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 43 2e-04 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 42 4e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 41 9e-04 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 41 9e-04 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 41 9e-04 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 40 0.002 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 39 0.003 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 39 0.003 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 38 0.005 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 38 0.008 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 38 0.008 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 37 0.011 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 37 0.014 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 36 0.019 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 36 0.025 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 36 0.025 At5g26200.1 68418.m03118 mitochondrial substrate carrier family ... 36 0.025 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 36 0.025 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 36 0.032 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 36 0.032 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 35 0.043 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 35 0.043 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 35 0.057 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 34 0.075 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 34 0.099 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 33 0.13 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 33 0.17 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 32 0.30 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 31 0.53 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 31 0.70 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 31 0.92 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 30 1.2 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 30 1.6 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 30 1.6 At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containi... 29 2.1 At4g15010.3 68417.m02307 mitochondrial substrate carrier family ... 29 2.1 At4g15010.2 68417.m02306 mitochondrial substrate carrier family ... 29 2.1 At4g15010.1 68417.m02305 mitochondrial substrate carrier family ... 29 2.1 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 29 2.1 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 29 2.8 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 29 3.7 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 28 4.9 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 28 4.9 At5g23940.1 68418.m02811 transferase family protein similar to a... 28 6.5 At3g17090.1 68416.m02180 protein phosphatase 2C family protein /... 28 6.5 At5g38730.1 68418.m04684 pentatricopeptide (PPR) repeat-containi... 27 8.6 At4g37590.1 68417.m05320 phototropic-responsive NPH3 family prot... 27 8.6 At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.6 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 111 bits (268), Expect = 3e-25 Identities = 44/81 (54%), Positives = 59/81 (72%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 433 +CGLTH V PLDLVKC +Q+D KYK++ +GF + ++E+GV+G +GW PT +GYS QG Sbjct: 88 SCGLTHMTVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGFFRGWVPTLLGYSAQG 147 Query: 434 LCKFGFYEVFKVAYAGMLDDE 496 CKFGFYE FK Y+ + E Sbjct: 148 ACKFGFYEYFKKTYSDLAGPE 168 Score = 77.0 bits (181), Expect = 1e-14 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +1 Query: 514 TFVYLAASASAEFIADIALSPMEAAKVRIQTMPGFASTLREAWPKMVKNEGYG 672 T +YLA SASAE IADIAL P EA KVR+QT PGFA + + +PK +K+EGYG Sbjct: 175 TLIYLAGSASAEIIADIALCPFEAVKVRVQTQPGFARGMSDGFPKFIKSEGYG 227 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +3 Query: 57 MFSSLLDAARNSPFRGPLSPAQCQSTVAPVAIEQTGGLAASAAVPTESCEFGSPKYFALC 236 + +L++ N+ F SPA S + I + L AS P + E SP ++A C Sbjct: 24 LLDQVLNSNSNAAFEKSPSPAPRSSPTS--MISRKNFLIASPTEPGKGIEMYSPAFYAAC 81 Query: 237 GVGGVL 254 GG+L Sbjct: 82 TFGGIL 87 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 105 bits (252), Expect = 3e-23 Identities = 39/83 (46%), Positives = 61/83 (73%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 433 +CG+THTA+ PLD++KC +Q+D KYKN+ + FK +++E+G++G +GW+PT +GYS QG Sbjct: 77 SCGITHTAITPLDVIKCNMQIDPLKYKNITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQG 136 Query: 434 LCKFGFYEVFKVAYAGMLDDETA 502 K+G YE K Y+ ++ E A Sbjct: 137 AFKYGLYEYAKKYYSDIVGPEYA 159 Score = 74.1 bits (174), Expect = 8e-14 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +1 Query: 514 TFVYLAASASAEFIADIALSPMEAAKVRIQTMPGFASTLREAWPKMVKNEGY 669 T +YLA SASAE +AD+AL PMEA KVR+QT PGFA L + PK++K+EG+ Sbjct: 164 TLIYLAGSASAEIVADVALCPMEAVKVRVQTQPGFARGLSDGLPKIIKSEGF 215 Score = 32.3 bits (70), Expect = 0.30 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 159 TGGLAASAAVPTESCEFGSPKYFALCGVGGVL 254 + G + + A P E E SP YFA C V G+L Sbjct: 45 SNGTSFAIATPNEKVEMYSPAYFAACTVAGML 76 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 80.2 bits (189), Expect = 1e-15 Identities = 33/78 (42%), Positives = 50/78 (64%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 433 + G TH A+ PLD++K +QV+ KY ++ +GF +RE G L +GW+ +GY +QG Sbjct: 28 SAGTTHLAITPLDVLKVNMQVNPVKYNSIPSGFSTLLREHGHSYLWRGWSGKLLGYGVQG 87 Query: 434 LCKFGFYEVFKVAYAGML 487 C+FG YE FK Y+ +L Sbjct: 88 GCRFGLYEYFKTLYSDVL 105 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/51 (49%), Positives = 36/51 (70%) Frame = +1 Query: 514 TFVYLAASASAEFIADIALSPMEAAKVRIQTMPGFASTLREAWPKMVKNEG 666 T +Y +SASA+ AD+AL P EA KVR+QT P FA L + +P++ ++EG Sbjct: 111 TSIYFLSSASAQIFADMALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEG 161 Score = 30.7 bits (66), Expect = 0.92 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 275 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 406 A+ P + +K R+Q K +++GF R EG+ G +G P Sbjct: 128 ALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFP 171 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 48.8 bits (111), Expect = 3e-06 Identities = 29/72 (40%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = +2 Query: 260 GLTH-TAVVPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 430 GLT +A PLDLV+ RL Y+ V + F+ REEG+ GL KG T +G Sbjct: 187 GLTAASATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPS 246 Query: 431 GLCKFGFYEVFK 466 F YE FK Sbjct: 247 LAISFAAYETFK 258 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Frame = +2 Query: 263 LTHTAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 412 ++ TA PLDLV+ R+Q++ A Y + G FK + EG+RGL +G P + Sbjct: 284 VSSTATFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEY 339 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 2/83 (2%) Frame = +2 Query: 254 AC-GLTHTAVV-PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 AC G++ T + PL+LVK RL + YK + + F +REEG L +G AP+ IG Sbjct: 212 ACAGVSQTLLTYPLELVKTRLTIQRGVYKGIFDAFLKIIREEGPTELYRGLAPSLIGVVP 271 Query: 428 QGLCKFGFYEVFKVAYAGMLDDE 496 + Y+ + AY E Sbjct: 272 YAATNYFAYDSLRKAYRSFSKQE 294 Score = 33.5 bits (73), Expect = 0.13 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 4/75 (5%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEK----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 421 A L+ TA PL++ + +QV A YKN+++ + EG+ G KG P+ + Sbjct: 308 AGALSSTATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKL 367 Query: 422 SMQGLCKFGFYEVFK 466 F YE K Sbjct: 368 VPAAGISFMCYEACK 382 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 44.8 bits (101), Expect = 5e-05 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (7%) Frame = +2 Query: 251 SACGLTHTAVVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 412 +A GL PLD+VK +LQ D K ++ + F+ V+++G RGLA+GW P Sbjct: 241 AAGGLAAAVTTPLDVVKTQLQCQGVCGCDRFKSSSISDVFRTIVKKDGYRGLARGWLPRM 300 Query: 413 IGYSMQGLCKFGFYEVFK 466 + ++ + YE K Sbjct: 301 LFHAPAAAICWSTYETVK 318 Score = 33.5 bits (73), Expect = 0.13 Identities = 22/70 (31%), Positives = 30/70 (42%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 463 P+D+VK RLQ+ YK V + K REEG + T + + F YE Sbjct: 152 PMDMVKQRLQIGNGTYKGVWDCIKRVTREEGFGAFYASYRTTVLMNAPFTAVHFTTYEAV 211 Query: 464 KVAYAGMLDD 493 K ML + Sbjct: 212 KRGLREMLPE 221 Score = 28.7 bits (61), Expect = 3.7 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 3/79 (3%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 424 A + H A+ P+D VK +Q K + F+ ++ +G L +G +G Sbjct: 48 AGSVEHMAMFPVDTVKTHMQALRSCPIKPIGIRQAFRSIIKTDGPSALYRGIWAMGLGAG 107 Query: 425 MQGLCKFGFYEVFKVAYAG 481 F FYEV K +G Sbjct: 108 PAHAVYFSFYEVSKKFLSG 126 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 44.0 bits (99), Expect = 9e-05 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +2 Query: 251 SACGLTHTAVV-PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 ++ G+ T V PL+++K RL V E Y ++ R +G+RG G PT +G Sbjct: 167 ASAGIASTLVCHPLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLP 226 Query: 428 QGLCKFGFYEVFKVAY 475 C + Y+ K +Y Sbjct: 227 YSTCYYFMYDKMKTSY 242 Score = 35.1 bits (77), Expect = 0.043 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 4/73 (5%) Frame = +2 Query: 260 GLTHTAV-VPLDLVKCRLQVDAEKYK---NVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 GLT + + PL++ + RL V A K + N+ V++EGV GL +GW + + Sbjct: 264 GLTASTISFPLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGWGASCLKVMP 323 Query: 428 QGLCKFGFYEVFK 466 + FYE +K Sbjct: 324 SSGITWVFYEAWK 336 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 44.0 bits (99), Expect = 9e-05 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 6/85 (7%) Frame = +2 Query: 260 GLTHTAVV-PLDLVKCRLQ-----VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 421 GL AV P D VK +LQ V +YKN ++ ++ EGV+GL +G +F+G Sbjct: 25 GLATVAVGHPFDTVKVKLQKHNTDVQGLRYKNGLHCASRILQTEGVKGLYRGATSSFMGM 84 Query: 422 SMQGLCKFGFYEVFKVAYAGMLDDE 496 + + FG Y K+ G L D+ Sbjct: 85 AFESSLMFGIYSQAKLFLRGTLPDD 109 Score = 30.7 bits (66), Expect = 0.92 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +2 Query: 284 PLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 439 P +LVKCR+Q+ +Y + ++ +V+ +GV G+ +G + T + Sbjct: 133 PTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLRECTGNAV 192 Query: 440 KFGFYEVFKVAYAGMLDD 493 F YE + L+D Sbjct: 193 FFTVYEYLRYHIHSRLED 210 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +2 Query: 272 TAVVPLDLVKCRLQVDAE----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 439 +A P+D+V+ RL V +Y+ + + +REEG R L +GW P+ IG Sbjct: 157 SATYPMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGL 216 Query: 440 KFGFYEVFK 466 F YE K Sbjct: 217 NFSVYESLK 225 Score = 40.7 bits (91), Expect = 9e-04 Identities = 28/71 (39%), Positives = 33/71 (46%), Gaps = 3/71 (4%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 424 A G++ TAV PL+ +K LQV KY V G K R EG+RGL KG Sbjct: 48 AGGVSRTAVAPLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIV 107 Query: 425 MQGLCKFGFYE 457 KF YE Sbjct: 108 PNSAVKFFSYE 118 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 42.7 bits (96), Expect = 2e-04 Identities = 26/73 (35%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 A +T PLD++K RL V +YK V + K +REEG L KG P + + Sbjct: 242 AGAVTGVLTTPLDVIKTRLMVQGSGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGI 301 Query: 428 QGLCKFGFYEVFK 466 G FG E K Sbjct: 302 GGSIFFGVLEKTK 314 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 41.9 bits (94), Expect = 4e-04 Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 6/83 (7%) Frame = +2 Query: 266 THTAVVPLDLVKCRLQVDAEK------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 T A+ LD+V+ R QV+ + YKN + R EG+RGL G+ P IG ++ Sbjct: 20 TVAAMHSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTV 79 Query: 428 QGLCKFGFYEVFKVAYAGMLDDE 496 F FY K YA DDE Sbjct: 80 SWGLYFFFYGRAKQRYARGRDDE 102 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 40.7 bits (91), Expect = 9e-04 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = +2 Query: 284 PLDLVKCRLQVD-AEKYKNVVN-GFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 457 P+D++K RLQ+D YK + + G KV VR EGVR L KG P +++ + G Sbjct: 33 PIDVIKTRLQLDRVGAYKGIAHCGSKV-VRTEGVRALWKGLTPFATHLTLKYTLRMGSNA 91 Query: 458 VFKVAY 475 +F+ A+ Sbjct: 92 MFQTAF 97 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +2 Query: 278 VVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 409 V P ++VK RLQ + KYK ++ + VREE + GL G APT Sbjct: 126 VTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPT 175 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +2 Query: 284 PLDLVKCRLQV---DAE---KYKNVVNGFKVSVREEGVRGLAKGWAP 406 P D+VK RL D+E +YK +V+ + EEG+ L +G P Sbjct: 230 PFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLP 276 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 40.7 bits (91), Expect = 9e-04 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = +2 Query: 284 PLDLVKCRL----QVDA---EK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 436 PLDLV+ +L QV A E+ Y+ +V+ F + RE G RGL +G AP+ G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 Query: 437 CKFGFYEVFK 466 KF FYE K Sbjct: 193 LKFYFYEEMK 202 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 260 GLTHTAVVPLDLVKCRLQVDAEKYKNV--VNGFKVSVREEGVRGLAKG 397 G+ TAV PL+ +K Q +++K + V + EG+ G +G Sbjct: 29 GIAKTAVAPLERIKILFQTRRDEFKRIGLVGSINKIGKTEGLMGFYRG 76 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 40.7 bits (91), Expect = 9e-04 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 2/77 (2%) Frame = +2 Query: 251 SACGLTHTAV-VPLDLVKCRLQV-DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 424 +A G+T T + +PLD ++ +L E + F+ ++ EG+ L KG P+ + Sbjct: 149 AAAGITATVLCLPLDTIRTKLVARGGEALGGIGGAFRYMIQTEGLFSLYKGLVPSIASMA 208 Query: 425 MQGLCKFGFYEVFKVAY 475 + G +G Y++ K ++ Sbjct: 209 LSGAVFYGVYDILKSSF 225 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 39.5 bits (88), Expect = 0.002 Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 5/89 (5%) Frame = +2 Query: 266 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 430 T A PL +VK RL + YK+V++ F EEGVRGL G P+ G S Sbjct: 131 TSIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHV 190 Query: 431 GLCKFGFYEVFKVAYAGMLDDETAYTTVP 517 + +F YE K Y +D+ + P Sbjct: 191 AI-QFPAYEKIK-QYMAKMDNTSVENLSP 217 Score = 37.9 bits (84), Expect = 0.006 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 8/80 (10%) Frame = +2 Query: 251 SACGLTHTAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAP 406 +A + T V PLD++K RLQV ++ ++ K ++EEG RG+ +G +P Sbjct: 26 TAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSP 85 Query: 407 TFIGYSMQGLCKFGFYEVFK 466 T I F Y K Sbjct: 86 TIIALLPNWAVYFSVYGKLK 105 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 6/78 (7%) Frame = +2 Query: 284 PLDLVKCRLQVDAE------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 445 P ++++ +LQ + KY V++ R EG+ GL +G A + + + F Sbjct: 237 PHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITF 296 Query: 446 GFYEVFKVAYAGMLDDET 499 YE+ + ++ ET Sbjct: 297 TTYEMMLRFFRQVVPPET 314 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 39.1 bits (87), Expect = 0.003 Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 9/86 (10%) Frame = +2 Query: 251 SACGLTHTAVVPLDLVKCRLQ---------VDAEKYKNVVNGFKVSVREEGVRGLAKGWA 403 +AC + +PLD K RLQ V KY+ ++ REEG+R L KG Sbjct: 21 AAC-VGEVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVV 79 Query: 404 PTFIGYSMQGLCKFGFYEVFKVAYAG 481 P + G + G YE K Y G Sbjct: 80 PGLHRQCLFGGLRIGMYEPVKNLYVG 105 Score = 35.9 bits (79), Expect = 0.025 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Frame = +2 Query: 284 PLDLVKCRLQVDAE-------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 442 P DLVK RLQ + + +Y +N + VR+EGVR L G P ++ + Sbjct: 134 PTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAE 193 Query: 443 FGFYEVFK 466 Y+ K Sbjct: 194 LASYDQVK 201 Score = 35.1 bits (77), Expect = 0.043 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 412 P+D+VK R+ D+ YK ++ F +++ +G KG+ P F Sbjct: 234 PVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNF 276 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 38.7 bits (86), Expect = 0.003 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 266 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 430 T A PL +VK RLQ + YK+ + + EEG+RGL G P G S Sbjct: 127 TTIATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHV 186 Query: 431 GLCKFGFYEVFKVAYA 478 + +F YE+ KV A Sbjct: 187 AI-QFPTYEMIKVYLA 201 Score = 34.3 bits (75), Expect = 0.075 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +2 Query: 272 TAVVPLDLVKCRLQV-------DAE-KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 T V PLD++K R QV DA K +V + + EG+RGL +G +PT + Sbjct: 29 TFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLS 88 Query: 428 QGLCKFGFYEVFK 466 F Y+ K Sbjct: 89 NWAIYFTMYDQLK 101 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 463 PLD ++ ++Q+ YK+V++ F + EGV GL +G+ P + K +++ Sbjct: 325 PLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIV 384 Query: 464 K 466 K Sbjct: 385 K 385 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 37.5 bits (83), Expect = 0.008 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +2 Query: 278 VVPLDLVKCRLQVDAEK---YKNVVNGFKVSVREEGVRGLAKGWAP 406 V P D+VK LQVD K Y ++ F+ ++ EGV+GL KG+ P Sbjct: 231 VYPTDVVKSVLQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGP 276 Score = 33.9 bits (74), Expect = 0.099 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 15/84 (17%) Frame = +2 Query: 284 PLDLVKCRLQ--------------VDAEKYKNVVNGFKVSVREEG-VRGLAKGWAPTFIG 418 P +L+KCRLQ V A KY ++ + +R EG RGL KG PTF Sbjct: 124 PTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPTFAR 183 Query: 419 YSMQGLCKFGFYEVFKVAYAGMLD 490 F YE FK AG D Sbjct: 184 EVPGNATMFAAYEAFKRFLAGGSD 207 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 37.5 bits (83), Expect = 0.008 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 7/91 (7%) Frame = +2 Query: 251 SACGLTHTAVVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 412 +A GL PLD+VK +LQ D ++ + + V+++G RGL +GW P Sbjct: 236 AAGGLAAAVTTPLDVVKTQLQCQGVCGCDRFTSSSISHVLRTIVKKDGYRGLLRGWLPRM 295 Query: 413 IGYSMQGLCKFGFYEVFKVAYAGM-LDDETA 502 + ++ + YE K + +D TA Sbjct: 296 LFHAPAAAICWSTYEGVKSFFQDFNVDSNTA 326 Score = 33.9 bits (74), Expect = 0.099 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 463 P+D+VK RLQ+ YK V + K +REEG+ + T + + F YE Sbjct: 150 PMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVHFATYEAA 209 Query: 464 K 466 K Sbjct: 210 K 210 Score = 29.1 bits (62), Expect = 2.8 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 424 A + H A+ P+D +K +Q K + F+ +++EG L +G +G Sbjct: 46 AGSVEHMAMFPVDTIKTHMQALRPCPLKPVGIREAFRSIIQKEGPSALYRGIWAMGLGAG 105 Query: 425 MQGLCKFGFYEVFK 466 F FYEV K Sbjct: 106 PAHAVYFSFYEVSK 119 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 37.1 bits (82), Expect = 0.011 Identities = 22/79 (27%), Positives = 38/79 (48%) Frame = +2 Query: 266 THTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 445 + TA PLD +K LQ+ + + K+ ++ GVRG +G + + + KF Sbjct: 222 SRTATAPLDRLKVLLQIQKTDAR-IREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKF 280 Query: 446 GFYEVFKVAYAGMLDDETA 502 YE+FK A + ++ A Sbjct: 281 YAYELFKNAIGENMGEDKA 299 Score = 36.7 bits (81), Expect = 0.014 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +2 Query: 272 TAVVPLDLVKCRLQVDAEKYKNVVNG-FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 448 T V PL +V+ R+Q AE+ + ++G F+ ++ EEG R L KG P + + Sbjct: 418 TCVYPLQVVRTRMQ--AERARTSMSGVFRRTISEEGYRALYKGLLPNLLKVVPAASITYM 475 Query: 449 FYEVFK 466 YE K Sbjct: 476 VYEAMK 481 Score = 28.3 bits (60), Expect = 4.9 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 4/75 (5%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVRE----EGVRGLAKGWAPTFIGY 421 A + ++ PLDLVK RLQ + V ++ EG R KG P+ +G Sbjct: 313 AGAVAQASIYPLDLVKTRLQTYTSQAGVAVPRLGTLTKDILVHEGPRAFYKGLFPSLLGI 372 Query: 422 SMQGLCKFGFYEVFK 466 YE K Sbjct: 373 IPYAGIDLAAYETLK 387 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 36.7 bits (81), Expect = 0.014 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 284 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 457 P DL++ L Q + + Y N+ + F V+ G++GL G +PT I +FG Y+ Sbjct: 146 PFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYD 205 Query: 458 VFK 466 FK Sbjct: 206 TFK 208 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 36.3 bits (80), Expect = 0.019 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 421 A GL+ PLD+VK RLQV KYK ++ R+EG +G +G P + Y Sbjct: 261 AGGLSAYLTTPLDVVKTRLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWY 318 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 35.9 bits (79), Expect = 0.025 Identities = 29/95 (30%), Positives = 38/95 (40%), Gaps = 12/95 (12%) Frame = +2 Query: 233 LRSWWCSACG--LTHTAVVPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEG 376 L ++ CSA +PLD K RLQ+ D E KY+ + REEG Sbjct: 13 LETFICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEG 72 Query: 377 VRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAG 481 + GL KG + G + G YE K G Sbjct: 73 ISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVG 107 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.9 bits (79), Expect = 0.025 Identities = 29/95 (30%), Positives = 38/95 (40%), Gaps = 12/95 (12%) Frame = +2 Query: 233 LRSWWCSACG--LTHTAVVPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEG 376 L ++ CSA +PLD K RLQ+ D E KY+ + REEG Sbjct: 13 LETFICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEG 72 Query: 377 VRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAG 481 + GL KG + G + G YE K G Sbjct: 73 ISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVG 107 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 412 P+D+VK R+ D+ Y+N V+ F +++ EG+ KG+ P F Sbjct: 236 PIDVVKSRMMGDST-YRNTVDCFIKTMKTEGIMAFYKGFLPNF 277 >At5g26200.1 68418.m03118 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 35.9 bits (79), Expect = 0.025 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 6/78 (7%) Frame = +2 Query: 251 SACGLTHTAVVPLDLVKCRLQV-DAE-----KYKNVVNGFKVSVREEGVRGLAKGWAPTF 412 +A G + +P+D +K RLQV DAE + V+ K ++E GV +G P + Sbjct: 257 TASGCSALVTMPVDTIKTRLQVLDAEENGRRRAMTVMQSVKSLMKEGGVGACYRGLGPRW 316 Query: 413 IGYSMQGLCKFGFYEVFK 466 + SM YE K Sbjct: 317 VSMSMSATTMITTYEFLK 334 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 35.9 bits (79), Expect = 0.025 Identities = 22/90 (24%), Positives = 47/90 (52%), Gaps = 10/90 (11%) Frame = +2 Query: 251 SACGLTHTAVV-PLDLVKCRLQVDAEK--------YKNVVNGFKVSVREEGVRGLAKGWA 403 SA G T + + LD + RL DA++ +K +++ ++ ++ +G++GL +G+ Sbjct: 123 SAAGATTSLFLYHLDYARTRLGTDAKECSVNGKRQFKGMIDVYRKTLSSDGIKGLYRGFG 182 Query: 404 PTFIGYSMQGLCKFGFYEVFK-VAYAGMLD 490 + +G ++ FG Y+ K + G L+ Sbjct: 183 VSIVGITLYRGMYFGMYDTIKPIVLVGSLE 212 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 35.5 bits (78), Expect = 0.032 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 5/75 (6%) Frame = +2 Query: 257 CGLTHTA-----VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 421 CG+T A V PL +++ R+Q D+ K ++ F ++R EG++G +G P F Sbjct: 399 CGMTSGALGASCVYPLQVIRTRMQADSSK-TSMGQEFLKTLRGEGLKGFYRGIFPNFFKV 457 Query: 422 SMQGLCKFGFYEVFK 466 + YE K Sbjct: 458 IPSASISYLVYEAMK 472 Score = 31.9 bits (69), Expect = 0.40 Identities = 23/76 (30%), Positives = 32/76 (42%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 433 A ++ TA PLD +K LQV VV K RE+ + G +G + + Sbjct: 214 AGAVSRTATAPLDRLKVALQVQRTNL-GVVPTIKKIWREDKLLGFFRGNGLNVAKVAPES 272 Query: 434 LCKFGFYEVFKVAYAG 481 KF YE+ K G Sbjct: 273 AIKFAAYEMLKPIIGG 288 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQ--VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 A + TA+ P+DLVK RLQ V + K +EG R +G P+ IG Sbjct: 305 AGAVAQTAIYPMDLVKTRLQTFVSEVGTPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIP 364 Query: 428 QGLCKFGFYEVFK 466 YE K Sbjct: 365 YAGIDLAAYETLK 377 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 35.5 bits (78), Expect = 0.032 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNG----FKVSVREEGVRGLAKGWAPTFIGY 421 A G+TH PLD+VK RLQ+ + + G F ++ EG R L G P Sbjct: 77 ATGVTH----PLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTRS 132 Query: 422 SMQGLCKFGFYEVFKVAY 475 + G + G YE KV++ Sbjct: 133 VLYGGLRLGLYEPTKVSF 150 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 35.1 bits (77), Expect = 0.043 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 284 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 457 P DL++ L Q + + Y + + F ++ G+RGL G PT + +FG Y+ Sbjct: 151 PFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYD 210 Query: 458 VFK 466 +FK Sbjct: 211 MFK 213 Score = 29.5 bits (63), Expect = 2.1 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 16/68 (23%) Frame = +2 Query: 260 GLTHTAVVPLDLVKCRLQVDAE----------------KYKNVVNGFKVSVREEGVRGLA 391 G++ + PLD++K R QV E KY +V K REEG RG Sbjct: 30 GVSRSVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASKYTGMVQATKDIFREEGFRGFW 89 Query: 392 KGWAPTFI 415 +G P + Sbjct: 90 RGNVPALL 97 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 35.1 bits (77), Expect = 0.043 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +2 Query: 275 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 454 A PLD+VK RLQ Y+ + + F+ SV++EG L +G + F Y Sbjct: 217 ACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAY 276 Query: 455 EV 460 EV Sbjct: 277 EV 278 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +1 Query: 526 LAASASAEFIADIALSPMEAAKVRIQTMPGFASTLREAWPKMVKNEGY 669 L A A + +A P++ K R+Q G + + + K VK EGY Sbjct: 204 LVAGGLAGVASWVACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGY 251 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 34.7 bits (76), Expect = 0.057 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +2 Query: 254 ACGLTHTA-----VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 418 +CG+T A V PL +V+ R+Q D+ K + F +++ EG+RG +G P + Sbjct: 399 SCGMTSGALGASCVYPLQVVRTRMQADSSK-TTMKQEFMNTMKGEGLRGFYRGLLPNLLK 457 Query: 419 YSMQGLCKFGFYEVFK 466 + YE K Sbjct: 458 VVPAASITYIVYEAMK 473 Score = 32.7 bits (71), Expect = 0.23 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFIGYS 424 A L TA+ P+DLVK RLQ + +K++ EG R KG P+ +G Sbjct: 306 AGALAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIV 365 Query: 425 MQGLCKFGFYEVFK 466 YE K Sbjct: 366 PYAGIDLAAYETLK 379 Score = 31.1 bits (67), Expect = 0.70 Identities = 22/76 (28%), Positives = 34/76 (44%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 433 A ++ TA PLD +K LQV + V+ K RE+ + G +G + + + Sbjct: 215 AGAVSRTATAPLDRLKVVLQVQ-RAHAGVLPTIKKIWREDKLMGFFRGNGLNVMKVAPES 273 Query: 434 LCKFGFYEVFKVAYAG 481 KF YE+ K G Sbjct: 274 AIKFCAYEMLKPMIGG 289 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 34.3 bits (75), Expect = 0.075 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = +2 Query: 260 GLTHTAV-VPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 430 GL T++ P D+VK R+ E Y+N + +V+ EG+R L KG+ PT+ Sbjct: 226 GLASTSLSCPADVVKTRMMNQGENAVYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPW 285 Query: 431 GLCKFGFYEVFKV 469 + YE F++ Sbjct: 286 QFVFWVSYEKFRL 298 Score = 31.5 bits (68), Expect = 0.53 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +2 Query: 284 PLDLVKCRLQVDAE--------KYKNVVNGFKVSVREEGVRGLAKGWAP 406 P DLVK R+Q D +Y + F ++ EGV+GL KG P Sbjct: 134 PADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 33.9 bits (74), Expect = 0.099 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +2 Query: 260 GLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSV-REEGVRGLAKGWAPTFIGYSMQGL 436 G+ P D++K R+ ++ VS+ R EG GL KG P F + G Sbjct: 733 GIAAVVTTPFDVMKTRMMTATPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAPLGA 792 Query: 437 CKFGFYEVFKVA 472 F YE+ K A Sbjct: 793 MNFAGYELAKKA 804 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 33.5 bits (73), Expect = 0.13 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = +2 Query: 260 GLTHTAVV-PLDLVKCRLQV--DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 430 G T +++ PLD +K RLQV E + K + E+G +G +G P F S Sbjct: 245 GATASSITTPLDTIKTRLQVMGHQENRPSAKQVVKKLLAEDGWKGFYRGLGPRFFSMSAW 304 Query: 431 GLCKFGFYEVFK 466 G YE K Sbjct: 305 GTSMILTYEYLK 316 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 406 + G+ PLD V+ ++Q+ YK++ F + +G+ GL +G+ P Sbjct: 287 SAGIATLTCYPLDTVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLP 337 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 8/83 (9%) Frame = +2 Query: 272 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 427 T PLD +K +Q A+K + + +EEGV+G KG P I Sbjct: 103 TVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLP 162 Query: 428 QGLCKFGFYEVFKVAYAGMLDDE 496 + YE +K + G DD+ Sbjct: 163 YSAVQLLAYESYKNLFKGK-DDQ 184 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 32.3 bits (70), Expect = 0.30 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 412 A ++ TA PLDLV+ R+QV+ A Y + G FK + EG +G+ +G P + Sbjct: 253 AGAVSSTATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEY 311 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 31.5 bits (68), Expect = 0.53 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 6/82 (7%) Frame = +2 Query: 251 SACGLTHTAVV-PLDLVKCRLQVD-----AEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 412 SA G T VV PLD+ RL D A +++ + + +++GVRG+ +G + Sbjct: 149 SAAGCTALIVVYPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASL 208 Query: 413 IGYSMQGLCKFGFYEVFKVAYA 478 G + FG ++ K ++ Sbjct: 209 HGVIIHRGLYFGGFDTVKEIFS 230 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 31.1 bits (67), Expect = 0.70 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +2 Query: 224 FRSLRSWWCSACGLTHTAVVPLDLVKCRLQV---DAEKYKNVVNGFKVSVREEGVRGLAK 394 F S W G A P+D V+ R+ + +A KYK+ + F V++EG + L K Sbjct: 291 FASFALGWLITNG-AGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFK 349 Query: 395 G 397 G Sbjct: 350 G 350 Score = 30.7 bits (66), Expect = 0.92 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 9/80 (11%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAP 406 + ++ TA P++ VK +Q E YK + + F ++R+EG+ L +G Sbjct: 94 SAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTA 153 Query: 407 TFIGYSMQGLCKFGFYEVFK 466 I Y F F + FK Sbjct: 154 NVIRYFPTQALNFAFKDYFK 173 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 30.7 bits (66), Expect = 0.92 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 329 YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 466 Y + ++ +E G RGL +G PT IG KF YE K Sbjct: 171 YSGIKEVLAMAYKEGGPRGLYRGIGPTLIGILPYAGLKFYIYEELK 216 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 2/74 (2%) Frame = +2 Query: 251 SACGLTHTAVVPLDLVKCRLQVDAEKYK--NVVNGFKVSVREEGVRGLAKGWAPTFIGYS 424 +A + TAV PL+ +K LQ +K V K ++ +G G KG + I Sbjct: 32 AAGAIAKTAVAPLERIKILLQTRTNDFKTLGVSQSLKKVLQFDGPLGFYKGNGASVIRII 91 Query: 425 MQGLCKFGFYEVFK 466 + YEV++ Sbjct: 92 PYAALHYMTYEVYR 105 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 9/80 (11%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAP 406 + ++ TA P++ VK +Q +E YK + + F +V++EG+ L +G Sbjct: 89 SAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTA 148 Query: 407 TFIGYSMQGLCKFGFYEVFK 466 I Y F F + FK Sbjct: 149 NVIRYFPTQALNFAFKDYFK 168 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +2 Query: 272 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 415 T +P +++K RLQ A ++ N+V + +EG++GL +G T + Sbjct: 133 TLRIPCEVLKQRLQ--ANQFDNIVEATVSTWHQEGLKGLFRGTGVTLL 178 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +2 Query: 275 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 418 A+ P L+K R QV + + F + VR EG+RGL +G+ + +G Sbjct: 44 ALYPAVLMKTRQQVCHSQGSCIKTAFTL-VRHEGLRGLYRGFGTSLMG 90 >At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 730 Score = 29.5 bits (63), Expect = 2.1 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%) Frame = +2 Query: 317 DAEKYKNVVNGF----KVSVREEGV-RGLAKGWAPTFI--GYSMQGLCKFGFYEVFK 466 DAE + +V+ G +++ + V R L +G+AP I GY M GLCK G + K Sbjct: 286 DAETFNDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAK 342 >At4g15010.3 68417.m02307 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 29.5 bits (63), Expect = 2.1 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 2/119 (1%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 457 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 458 VFKVAYAGMLDDETAYTTVPSCTWRRLRRRNSSPTLPCRPWRRLRSVSKPCLVSRAPSA 634 + Y D Y +V L ++ T+ P+ ++ + SRAP+A Sbjct: 90 ILTAFYKDGRHDN--YVSVGEAFLAGL-VGGAAETVMTSPFELIKVRKQVTAASRAPNA 145 >At4g15010.2 68417.m02306 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 29.5 bits (63), Expect = 2.1 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 2/119 (1%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 457 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 458 VFKVAYAGMLDDETAYTTVPSCTWRRLRRRNSSPTLPCRPWRRLRSVSKPCLVSRAPSA 634 + Y D Y +V L ++ T+ P+ ++ + SRAP+A Sbjct: 90 ILTAFYKDGRHDN--YVSVGEAFLAGL-VGGAAETVMTSPFELIKVRKQVTAASRAPNA 145 >At4g15010.1 68417.m02305 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 29.5 bits (63), Expect = 2.1 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 2/119 (1%) Frame = +2 Query: 284 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 457 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 458 VFKVAYAGMLDDETAYTTVPSCTWRRLRRRNSSPTLPCRPWRRLRSVSKPCLVSRAPSA 634 + Y D Y +V L ++ T+ P+ ++ + SRAP+A Sbjct: 90 ILTAFYKDGRHDN--YVSVGEAFLAGL-VGGAAETVMTSPFELIKVRKQVTAASRAPNA 145 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 362 VREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 466 +REEG+R L G + T + ++ + G Y++ K Sbjct: 72 IREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIK 106 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 12/65 (18%) Frame = +2 Query: 257 CGLTHTAV-----VPLDLVKCRLQVD----AEKYKNVVNGFKVSVR---EEGVRGLAKGW 400 CGLT A+ P DL R+Q D + +N N F R +EGV L KG Sbjct: 111 CGLTAGAIGACVGSPADLALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGC 170 Query: 401 APTFI 415 PT + Sbjct: 171 GPTVV 175 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 284 PLDLVKCRLQ-VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 409 P+D+VK R+ D E Y ++ V EEG L KG PT Sbjct: 268 PIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPT 310 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 9/80 (11%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAP 406 + ++ TA P++ VK +Q +E YK + + F ++++EG L +G Sbjct: 90 SAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTA 149 Query: 407 TFIGYSMQGLCKFGFYEVFK 466 I Y F F + FK Sbjct: 150 NVIRYFPTQALNFAFKDYFK 169 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 9/80 (11%) Frame = +2 Query: 254 ACGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAP 406 + ++ TA P++ VK +Q +E YK + + F ++++EG L +G Sbjct: 90 SAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTA 149 Query: 407 TFIGYSMQGLCKFGFYEVFK 466 I Y F F + FK Sbjct: 150 NVIRYFPTQALNFAFKDYFK 169 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 363 TDTLKPFTTFLYFSASTWRRHFTRSRG 283 +D+ KPF+TF ++ W RH T +RG Sbjct: 263 SDSSKPFSTFQSLTSHIW-RHVTLARG 288 >At3g17090.1 68416.m02180 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 384 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 3/69 (4%) Frame = -2 Query: 450 KPNLQRPCIEYPMKVGAHPLARP---RTPSSRTDTLKPFTTFLYFSASTWRRHFTRSRGT 280 +P + I ++ A P+ RP TP+ + L P +FL F++ H T + Sbjct: 244 RPEFNKEPISQKFRI-AEPMKRPLMSATPTILSHPLHPNDSFLIFASDGLWEHLTNEKAV 302 Query: 279 TAVWVRPHA 253 V P A Sbjct: 303 EIVHNHPRA 311 >At5g38730.1 68418.m04684 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 596 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +2 Query: 245 WCSACGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGF-KV----SVREEGVRGLAKGWAPT 409 +C + V +++ L++D YK +++GF KV + +EE + KG++P Sbjct: 387 YCKIEDMVSAVKVKKKMIESGLKLDMYSYKALIHGFCKVLELENAKEELFSMIEKGFSPG 446 Query: 410 FIGYS 424 + YS Sbjct: 447 YATYS 451 >At4g37590.1 68417.m05320 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 580 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = -3 Query: 302 TSPGRGAPRPCGSDRMQNTTNSAKSEIFRRSKFTGLRGYRSRRRQATGLLDSH 144 +S G P + R NTT+ +E + LRG + R A +SH Sbjct: 472 SSTGNSTPEVIPASRSTNTTDQEDTECWDTEDIKALRGELANLRLAKNQQESH 524 >At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 305 RLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 445 R + EK + + GF+ V+ +G+ + +GWAP + Q C F Sbjct: 325 RKNIGIEKEEWLPEGFEERVKGKGM--IIRGWAPQVLILDHQATCGF 369 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,939,161 Number of Sequences: 28952 Number of extensions: 328599 Number of successful extensions: 1131 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -