BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021677 (676 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 104 5e-23 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 104 5e-23 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.1 At2g44980.2 68415.m05601 transcription regulatory protein SNF2, ... 29 2.8 At2g44980.1 68415.m05600 transcription regulatory protein SNF2, ... 29 2.8 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 28 5.0 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 5.0 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 6.6 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 6.6 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 27 8.7 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 27 8.7 At5g01010.1 68418.m00001 expressed protein 27 8.7 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 27 8.7 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 8.7 At1g76010.1 68414.m08825 expressed protein 27 8.7 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 104 bits (250), Expect = 5e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +2 Query: 254 SESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 400 +ESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 70 AESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 71.3 bits (167), Expect = 5e-13 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = +3 Query: 66 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 239 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 240 GHQTS 254 GHQTS Sbjct: 65 GHQTS 69 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 442 SVAATGVPALVQARGHIIEKIPGFP 516 ++AAT VPALV ARGH IE +P P Sbjct: 133 AIAATAVPALVMARGHKIENVPEMP 157 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 104 bits (250), Expect = 5e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +2 Query: 254 SESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 400 +ESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 69 AESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 73.3 bits (172), Expect = 1e-13 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +3 Query: 57 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 230 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 231 KEAGHQTS 254 K+AGHQTS Sbjct: 61 KKAGHQTS 68 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 442 SVAATGVPALVQARGHIIEKIPGFP 516 ++AAT VPALV ARGH IE +P P Sbjct: 132 AIAATAVPALVMARGHKIENVPEMP 156 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 81 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At2g44980.2 68415.m05601 transcription regulatory protein SNF2, putative similar to SNF2P [Oryza sativa (japonica cultivar-group)] GI:23193483; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; CG donor site annotated in one isoform based on protein alignments. Length = 870 Score = 29.1 bits (62), Expect = 2.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 548 VDLLDFVGYNQGKPGIFSIMCPLA*T 471 + L ++ + QG PG F ++CPL+ T Sbjct: 88 ISFLSYLKFRQGLPGPFLVLCPLSVT 113 >At2g44980.1 68415.m05600 transcription regulatory protein SNF2, putative similar to SNF2P [Oryza sativa (japonica cultivar-group)] GI:23193483; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; CG donor site annotated in one isoform based on protein alignments. Length = 851 Score = 29.1 bits (62), Expect = 2.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 548 VDLLDFVGYNQGKPGIFSIMCPLA*T 471 + L ++ + QG PG F ++CPL+ T Sbjct: 88 ISFLSYLKFRQGLPGPFLVLCPLSVT 113 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +2 Query: 206 LEAALLREQGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 376 + AL+R + G P +E + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRRMGAKPT-AEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 377 TKPW 388 W Sbjct: 135 ISKW 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 132 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 132 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHHGHAEF 288 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 135 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 22 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 371 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQTG 249 R++ H + +H D + E+HHH H R+H ++ G Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEHG 776 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 371 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQTG 249 R++ H + +H D + E+HHH H R+H ++ G Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEHG 776 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 254 TGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 126 TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 204 TGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 230 QGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 361 QGG Q G GR R +GGG + G G+ G+ CR G Sbjct: 79 QGGGGRYQG---GGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 276 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +2 Query: 230 QGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 358 +GG+ Q G GR R R RGGG R G G F N G Sbjct: 305 RGGYDGPQGRGRGRGRG--RGGRGRGGG--RGGDGGFNNRSDG 343 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,146,394 Number of Sequences: 28952 Number of extensions: 296323 Number of successful extensions: 1028 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -