BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021675 (706 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 30 1.9 AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical ... 28 5.7 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 402 RERTTSGQRSQRARHRGGLSAGGAAREGVXADPRARRESP 521 RER +S RS RAR+ GG GG G + + RE+P Sbjct: 35 RERESSRSRSPRARYGGGGGGGGGGGRG--RNQQYDRENP 72 >AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical protein Y40C5A.3 protein. Length = 2344 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +3 Query: 411 TTSGQRSQRAR-----HRGGLSAGGAAREGVXADPRARRESPVGPGAHVIIDVAGRRLAA 575 +T+G +SQ+ R HR G++ A + + + SP PG II VAG R ++ Sbjct: 1447 STTGHQSQQTRPTPTTHRPGITPPLAPKTIYPSSLQTGSSSPTPPGTSSIIVVAGSRASS 1506 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,915,205 Number of Sequences: 27780 Number of extensions: 253926 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -