BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021674 (701 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 27 2.6 SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ... 25 7.9 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 27.1 bits (57), Expect = 2.6 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -2 Query: 328 SPYAY*TSGSSQLLPFCSTRGF-----CPRELALGHLRYSLTDVPPQSNSP 191 SPYA+ T S+ L PF STR + P+ L L LR+ L ++ P Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSYMGAIPTPQLLDLRALRHGLIQPCESADKP 1261 >SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces pombe|chr 3|||Manual Length = 278 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/51 (21%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 221 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR-LERNTVRPPILST 72 D + LP+ + P + K+ ++F P+HH + + ++ +P +T Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHHKKQDINASSAQPKSTTT 198 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,980,391 Number of Sequences: 5004 Number of extensions: 61583 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -