BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021674 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53460.1 68418.m06644 glutamate synthase [NADH], chloroplast,... 30 1.7 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.9 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 3.9 At3g62370.1 68416.m07006 expressed protein 28 6.9 At4g29310.1 68417.m04190 expressed protein 27 9.1 At3g47910.1 68416.m05224 expressed protein low similarity to non... 27 9.1 At3g06510.1 68416.m00755 glycosyl hydrolase family 1 protein sim... 27 9.1 >At5g53460.1 68418.m06644 glutamate synthase [NADH], chloroplast, putative similar to SP|Q03460 Glutamate synthase [NADH], chloroplast precursor (EC 1.4.1.14) (NADH- GOGAT) {Medicago sativa} Length = 2208 Score = 29.9 bits (64), Expect = 1.7 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 160 PRD-PVRGHCQAGSLTGAVHLSKNNAGVLRPAHEDRNLAWSKRAKAGLIQMFSTHRDCES 336 PRD PV G +G L N +L HED N +K K +I T DC Sbjct: 1946 PRDLPVPGRDLSGVHFAMEFLHANTKSLLDSNHEDGNYISAKGKKVVVIGGGDTGTDCIG 2005 Query: 337 TAYR 348 T+ R Sbjct: 2006 TSIR 2009 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 283 RAKAGLIQMFSTHRDCESTAYRSFSIK 363 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -2 Query: 214 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 98 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 199 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 104 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -1 Query: 458 IEGSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIK 297 I G K ++ ++ + + + CG SG K+ + D A LS+++ N W K Sbjct: 85 ISGKKISLRVSVYAGRTGHTCGVASGKLLGKVEVAVDLAAALSRTVAFHNGWKK 138 >At3g47910.1 68416.m05224 expressed protein low similarity to nonmuscle myosin heavy chain (NMHC) [Homo sapiens] GI:189036; contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1290 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 114 TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 19 T+G+ HR+ AD ++ +PLP V + + +V Sbjct: 972 TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003 >At3g06510.1 68416.m00755 glycosyl hydrolase family 1 protein similar to Beta-galactosidase (SP:P22498) [Sulfolobus solfataricus}; almost identical to beta-glucosidase GB:AAF23823 GI:6685165 from [Arabidopsis thaliana] Length = 622 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = +1 Query: 175 RGHCQAGSLTGAVHLSKNNAGVLRPAHEDRNLAWS---KRAKAGLIQMFSTHRDCESTAY 345 R H A +L + HL + +DR+LAW+ K AKAG ++ F D + Y Sbjct: 490 RSHDLARTLRQSYHLFSKIVKSGKVTRKDRSLAWNELQKAAKAGKLRPFYRGVDNHNLMY 549 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,995,839 Number of Sequences: 28952 Number of extensions: 345791 Number of successful extensions: 870 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -