BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021673 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 54 8e-08 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 52 4e-07 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 50 1e-06 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 50 2e-06 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 50 2e-06 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 50 2e-06 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 50 2e-06 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 50 2e-06 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 49 3e-06 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 48 5e-06 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) 44 1e-04 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 44 1e-04 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 41 8e-04 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 41 8e-04 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 40 0.001 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 40 0.002 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20253| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_49552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19196| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 38 0.007 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -3 Query: 193 TTVHAKPFSTSVLQGLAGVFATTTKICTDGGFQAAHAQTLLRSPSRTSYSLRL 35 T VH +PFSTSV + L +FATTTKICT G F A A+ + +P+ SYS L Sbjct: 113 TAVHMEPFSTSVFKALIRIFATTTKICTGGRFTQARARGCVTTPT-PSYSSEL 164 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALRVPNH 484 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + G +R +H Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMRPYDH 108 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/49 (51%), Positives = 32/49 (65%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP+F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPDFQGSSRAHRTPQEV 100 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 52.0 bits (119), Expect = 4e-07 Identities = 38/92 (41%), Positives = 47/92 (51%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALRVPNHISL 475 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP + SL Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQE-------GESSL 104 Query: 474 L*DSMELERSGRKENSSRTSRRRLQATLGYPV 379 RKENSS+ R+RL+ L Y + Sbjct: 105 ----------KRKENSSQGPRQRLRVRLRYRI 126 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/49 (51%), Positives = 32/49 (65%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP FS ++ + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFSGASRAHRTPQEV 89 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 101 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 101 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 89 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 89 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 89 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 106 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 152 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 89 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 100 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.8 bits (116), Expect = 9e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 213 DRLTREQLLFTRNPSPRQSSRASLEYLLLPPRSA 112 DRLT QLLFT N SP +SS+ S EYLLLPPRSA Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEYLLLPPRSA 122 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/48 (50%), Positives = 29/48 (60%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 511 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE 88 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/48 (52%), Positives = 30/48 (62%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 511 PYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP + Sbjct: 206 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQE 251 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F S+ RTP ++ Sbjct: 93 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRVHRTPQEV 139 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 10 PYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 56 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP +I Sbjct: 159 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEI 205 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 92 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 138 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 92 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 138 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 127 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 173 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 49 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 95 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 26 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 72 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 9 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 55 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 127 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 173 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 127 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 173 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 61 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 107 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 196 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 242 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 64 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 110 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 9 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 55 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 92 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 138 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 16 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 62 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 166 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 212 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 127 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 173 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 126 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 172 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 10 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 56 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 127 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 173 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 9 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 55 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 75 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 121 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 269 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 315 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 165 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 211 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 61 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 107 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/54 (44%), Positives = 31/54 (57%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALRV 493 PYLH SI+ RL TLETCCGY Y+ R P+ EF + S R+ A+ + Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTRKSMSSPNIEFLQPGGSTRSRASAAAVEL 107 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 165 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 211 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 152 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 198 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 92 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 138 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 53 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 99 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 93 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 139 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 92 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 138 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 43 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 89 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLHTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/49 (48%), Positives = 29/49 (59%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYNRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/53 (47%), Positives = 30/53 (56%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALR 496 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + R Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEFSRPR 104 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 529 PYLH SI+ RL TLETCCGY Y+ R PEFSR ES Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSFPEFSRVVES 93 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/48 (50%), Positives = 29/48 (60%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 511 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + Sbjct: 193 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE 238 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/48 (50%), Positives = 29/48 (60%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 511 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE 99 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/48 (50%), Positives = 29/48 (60%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 511 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP + Sbjct: 92 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE 137 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/49 (46%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH +I+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 67 PYLHCAINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 113 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTP 517 PYLH SI+ RL TLETCCGY Y+ R SP F + + RTP Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTP 97 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/49 (46%), Positives = 30/49 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL TLETCCGY Y+ R P+ F + + RTP ++ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTRKSMSFPN--FQGPSRAHRTPQEV 100 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 PYLH SI+ RL LETCCGY Y+ R SP F + + RTP ++ Sbjct: 54 PYLHCSINQRLLKLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 100 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 529 PYLH SI+ RL TLETCCGY Y+ R SP F + ES Sbjct: 9 PYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGAVES 48 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQI 508 P LH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ Sbjct: 55 PLLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEV 101 >SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = -3 Query: 193 TTVHAKPFSTSVLQGLAGVFATTTKICTDGGFQAAHAQTLLRSPS 59 T VH PFSTS Q L +FATTTKIC G F + + +P+ Sbjct: 48 TAVHMDPFSTSGFQALILIFATTTKICPGGRFTQGSGKGWVTTPT 92 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/45 (48%), Positives = 26/45 (57%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 520 PYLH SI+ RL TLETCCGY Y+ R SP F ++ T Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGRQDATET 96 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPAR 577 PYLH SI+ RL TLETCCGY Y+ R Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPAR 577 PYLH SI+ RL TLETCCGY Y+ R Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPAR 577 PYLH SI+ RL TLETCCGY Y+ R Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPAR 577 PYLH SI+ RL TLETCCGY Y+ R Sbjct: 54 PYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYEPAR 577 PYLH SI+ RL TLETCCGY Y+ R Sbjct: 749 PYLHCSINQRLLTLETCCGYEYDRTR 774 >SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/48 (43%), Positives = 27/48 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALRVPNH 484 RL TLETCCGY Y+ R SP F + + RTP + G +R +H Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMRPYDH 46 >SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/48 (43%), Positives = 27/48 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALRVPNH 484 RL TLETCCGY Y+ R SP F + + RTP + G +R +H Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMRPYDH 46 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 654 PYLHYSID*RLFTLETCCGYGYE 586 PYLH SI+ RL TLETCCGY Y+ Sbjct: 54 PYLHCSINQRLLTLETCCGYEYD 76 >SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGAL 499 RL TLETCCGY Y+ R SP+F + + RTP + GAL Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPKFQGPSRAHRTPQKCGAL 41 >SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALR 496 RL TLETCCGY Y+ R SP F + + RTP + G +R Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMR 42 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALR 496 RL TLETCCGY Y+ R SP F + + RTP + G +R Sbjct: 74 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMR 115 >SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALR 496 RL TLETCCGY Y+ R SP F + + RTP + G +R Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMR 42 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALR 496 RL TLETCCGY Y+ R SP F + + RTP + G +R Sbjct: 112 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMR 153 >SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALR 496 RL TLETCCGY Y+ R SP F + + RTP + G +R Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQETGRMR 42 >SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQIGALR 496 RL TLETCCGY Y+ R SP F + + RTP + G +R Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFRGPSRAHRTPQETGRMR 42 >SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -1 Query: 627 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 529 RL TLETCCGY Y+ R SPEFSR+ ES Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPEFSRAVES 31 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +2 Query: 50 GRARRRAQKGLGVSRLEASVGADLGGSSKYSSEALED*RGEGF 178 GR R A G + E + ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLG--ETASSADLGGSSKYSNESFEDRSGERF 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,272,448 Number of Sequences: 59808 Number of extensions: 479512 Number of successful extensions: 3627 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2899 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -