BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021673 (654 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens ... 31 3.6 AL161954-1|CAB82305.1| 110|Homo sapiens hypothetical protein pr... 31 4.7 AB033092-1|BAA86580.1| 601|Homo sapiens KIAA1266 protein protein. 31 4.7 AF058073-1|AAC15442.1| 108|Homo sapiens immunoglobulin lambda l... 30 8.3 AF058071-1|AAC15440.1| 108|Homo sapiens immunoglobulin lambda l... 30 8.3 >AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens cDNA FLJ43705 fis, clone TESOP2001818. ). Length = 321 Score = 31.1 bits (67), Expect = 3.6 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 312 PIPEPGSGTVSIIVPSSLKTSVRRGNPKWPEDAAER 419 P+P G+ T ++PS+L+ ++ G P W ED+ R Sbjct: 228 PLPPKGTETFFCVLPSALRAALSCG-PSWGEDSGPR 262 >AL161954-1|CAB82305.1| 110|Homo sapiens hypothetical protein protein. Length = 110 Score = 30.7 bits (66), Expect = 4.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 576 HLHVHPS--PEFSRSAESIRTPPQIGALRVPNHISL 475 +L +HP+ P RS S++TP L PNH SL Sbjct: 52 YLEIHPAKKPNVIRSTPSLQTPTTKRMLTTPNHTSL 87 >AB033092-1|BAA86580.1| 601|Homo sapiens KIAA1266 protein protein. Length = 601 Score = 30.7 bits (66), Expect = 4.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 576 HLHVHPS--PEFSRSAESIRTPPQIGALRVPNHISL 475 +L +HP+ P RS S++TP L PNH SL Sbjct: 543 YLEIHPAKKPNVIRSTPSLQTPTTKRMLTTPNHTSL 578 >AF058073-1|AAC15442.1| 108|Homo sapiens immunoglobulin lambda light chain VJ region protein. Length = 108 Score = 29.9 bits (64), Expect = 8.3 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 257 IIFKNNEK*RPLSERESGSYSGT 325 +IFK++E+ + ER SGSYSGT Sbjct: 46 VIFKDDERPSGIPERFSGSYSGT 68 >AF058071-1|AAC15440.1| 108|Homo sapiens immunoglobulin lambda light chain VJ region protein. Length = 108 Score = 29.9 bits (64), Expect = 8.3 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 257 IIFKNNEK*RPLSERESGSYSGT 325 +IFK++E+ + ER SGSYSGT Sbjct: 46 VIFKDDERPSGIPERFSGSYSGT 68 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,516,428 Number of Sequences: 237096 Number of extensions: 2398790 Number of successful extensions: 7739 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7730 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -