Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021391
         (464 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    24   0.70 
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    22   3.7  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    21   4.9  

>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 24.2 bits (50), Expect = 0.70
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +2

Query: 83  LSTKSSKQLNSVAKQFGSIGRSMSSKIKKNSG 178
           LST +S    +VAKQ   +  + SS +  NSG
Sbjct: 512 LSTATSTCSLAVAKQQNQVPLTSSSNVNNNSG 543


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 21.8 bits (44), Expect = 3.7
 Identities = 7/11 (63%), Positives = 11/11 (100%)
 Frame = -2

Query: 172 ILLYLTAHRPA 140
           IL+++T+HRPA
Sbjct: 18  ILIFVTSHRPA 28


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 112 FCRQTVWQHRQVY 150
           FC Q +WQ + V+
Sbjct: 360 FCSQCIWQEKIVF 372


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,897
Number of Sequences: 438
Number of extensions: 2035
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12436029
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)