BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021390 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 1.8 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 27 1.8 SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 26 4.2 SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb... 26 5.5 SPAC4G8.06c |trm12||tRNA methyltransferase Trm12 |Schizosaccharo... 25 9.7 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 25 9.7 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 27.5 bits (58), Expect = 1.8 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 52 VNPWNPIEGRYGSEREEHRI 111 +NP+ P+EG Y + ++ HRI Sbjct: 1 MNPYEPVEGLYVNAKQYHRI 20 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 508 RKIRGRPENAGPDPVRNVRRFSRV 437 R I GRPEN G ++N+ R S+V Sbjct: 215 RTIPGRPENGGNCDIKNLSRGSKV 238 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 26.2 bits (55), Expect = 4.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 328 SGCXRCRVWSMFVRYVILAS*YFNIMRPQKLYIF 429 +GC + VW +VR+V Y LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1095 Score = 25.8 bits (54), Expect = 5.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 185 FVPISAAGLQGEEPLVDRIMSKGIG 259 F+P A G+Q EP + + S GIG Sbjct: 910 FLPYLAEGIQSSEPEIRQAASYGIG 934 >SPAC4G8.06c |trm12||tRNA methyltransferase Trm12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 418 Score = 25.0 bits (52), Expect = 9.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 19 RSGKSFLFCLSVNPWN 66 ++G S +FC +NPW+ Sbjct: 265 KAGASTVFCWEINPWS 280 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 201 ADMGTNXXDISTYIPHLNFQGPQRVSGH 118 A GT+ +IST +P P++VSGH Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGH 398 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,623,324 Number of Sequences: 5004 Number of extensions: 50429 Number of successful extensions: 132 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -