BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021390 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 66 2e-11 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 62 3e-10 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 62 4e-10 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 62 4e-10 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 61 7e-10 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 60 2e-09 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 60 2e-09 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 55 6e-08 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54855| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 42 6e-04 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 42 6e-04 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 42 6e-04 SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 40 0.001 SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_49552| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40120| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_18006| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_20253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_27595| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4740| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_22744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_19196| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 37 0.013 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 66.1 bits (154), Expect = 2e-11 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRKCGALRVPNH 83 P++ G +R +H Sbjct: 97 PQETGRMRPYDH 108 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 63.3 bits (147), Expect = 2e-10 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.9 bits (146), Expect = 2e-10 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP+F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPDFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 62.5 bits (145), Expect = 3e-10 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 1/80 (1%) Frame = -2 Query: 346 GTGXIRFPSKPDTPRSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHL 170 G G + P P + EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R Sbjct: 238 GPGPLASSLSPTDP-TLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKS 296 Query: 169 XVHPSPEFSRSAESIRTPRK 110 SP F + + RTP++ Sbjct: 297 M--SSPNFQGPSRAHRTPQE 314 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP FS ++ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFSGASRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = -2 Query: 316 PDTPRSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSR 140 P + EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F Sbjct: 84 PRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQG 141 Query: 139 SAESIRTPRK 110 S+ + RTP++ Sbjct: 142 SSRAHRTPQE 151 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.1 bits (144), Expect = 4e-10 Identities = 39/76 (51%), Positives = 44/76 (57%), Gaps = 2/76 (2%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESI-R 122 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R PEFSR ES Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SFPEFSRVVESAPG 96 Query: 121 TPRKCGALRVPNHISL 74 +KCG H++L Sbjct: 97 HHKKCGGF--TEHLTL 110 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 191 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 248 Query: 118 PRK 110 P++ Sbjct: 249 PQE 251 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 61.3 bits (142), Expect = 7e-10 Identities = 33/69 (47%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R P+ EF + S R+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSPNIEFLQPGGSTRS 98 Query: 118 PRKCGALRV 92 A+ + Sbjct: 99 RASAAAVEL 107 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 60.9 bits (141), Expect = 9e-10 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL+PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILLPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 60.9 bits (141), Expect = 9e-10 Identities = 34/63 (53%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F S+ RT Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGSSRVHRT 135 Query: 118 PRK 110 P++ Sbjct: 136 PQE 138 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 178 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 235 Query: 118 PRK 110 P++ Sbjct: 236 PQE 238 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 134 Query: 118 PRK 110 P++ Sbjct: 135 PQE 137 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 134 Query: 118 PRK 110 P++ Sbjct: 135 PQE 137 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 169 Query: 118 PRK 110 P++ Sbjct: 170 PQE 172 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 34 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 91 Query: 118 PRK 110 P++ Sbjct: 92 PQE 94 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 169 Query: 118 PRK 110 P++ Sbjct: 170 PQE 172 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 169 Query: 118 PRK 110 P++ Sbjct: 170 PQE 172 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 103 Query: 118 PRK 110 P++ Sbjct: 104 PQE 106 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 181 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 238 Query: 118 PRK 110 P++ Sbjct: 239 PQE 241 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 49 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 106 Query: 118 PRK 110 P++ Sbjct: 107 PQE 109 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 134 Query: 118 PRK 110 P++ Sbjct: 135 PQE 137 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 134 Query: 118 PRK 110 P++ Sbjct: 135 PQE 137 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 151 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 208 Query: 118 PRK 110 P++ Sbjct: 209 PQE 211 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 169 Query: 118 PRK 110 P++ Sbjct: 170 PQE 172 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 111 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 168 Query: 118 PRK 110 P++ Sbjct: 169 PQE 171 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 169 Query: 118 PRK 110 P++ Sbjct: 170 PQE 172 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 97 Query: 118 PRK 110 P++ Sbjct: 98 PQE 100 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 60 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 117 Query: 118 PRK 110 P++ Sbjct: 118 PQE 120 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 207 Query: 118 PRK 110 P++ Sbjct: 208 PQE 210 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 46 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 103 Query: 118 PRK 110 P++ Sbjct: 104 PQE 106 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 207 Query: 118 PRK 110 P++ Sbjct: 208 PQE 210 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 137 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 194 Query: 118 PRK 110 P++ Sbjct: 195 PQE 197 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 134 Query: 118 PRK 110 P++ Sbjct: 135 PQE 137 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 135 Query: 118 PRK 110 P++ Sbjct: 136 PQE 138 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 134 Query: 118 PRK 110 P++ Sbjct: 135 PQE 137 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 85 Query: 118 PRK 110 P++ Sbjct: 86 PQE 88 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLHTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.3 bits (137), Expect = 3e-09 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYNRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.3 bits (137), Expect = 3e-09 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R P+ F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSFPN--FQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 58.8 bits (136), Expect = 4e-09 Identities = 33/66 (50%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL KLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP++ Sbjct: 94 HRTPQE 99 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.8 bits (136), Expect = 4e-09 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H +I+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 52 EPILFPKLRIYFADFPYLHCAINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 109 Query: 118 PRK 110 P++ Sbjct: 110 PQE 112 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 58.4 bits (135), Expect = 5e-09 Identities = 32/63 (50%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI F D H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFVDFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 58.4 bits (135), Expect = 5e-09 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 +PIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 38 KPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 95 Query: 118 PRK 110 P++ Sbjct: 96 PQE 98 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 57.6 bits (133), Expect = 8e-09 Identities = 32/63 (50%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL LETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLKLETCCGYEYDRTRKSM--SSPNFQGPSRAHRT 96 Query: 118 PRK 110 P++ Sbjct: 97 PQE 99 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 57.6 bits (133), Expect = 8e-09 Identities = 33/64 (51%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F E Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGRRERTGH 96 Query: 118 PRKC 107 +KC Sbjct: 97 HKKC 100 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 57.6 bits (133), Expect = 8e-09 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAES 128 +S EPIL KLRI FAD H SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRA 93 Query: 127 IRTPRK 110 RTP + Sbjct: 94 HRTPTR 99 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 56.8 bits (131), Expect = 1e-08 Identities = 32/62 (51%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R SP F ++ T Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGRQDATET 96 Query: 118 PR 113 R Sbjct: 97 TR 98 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 56.0 bits (129), Expect = 3e-08 Identities = 33/67 (49%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRT 119 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ + + F E Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDGHENQCL--PRIFKGRRERTGH 96 Query: 118 PRKCGAL 98 +KCGAL Sbjct: 97 HKKCGAL 103 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/48 (58%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPS 155 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R P+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSPN 86 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/48 (58%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPS 155 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R P+ Sbjct: 734 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSPN 781 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = -2 Query: 295 EPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXR 176 EPIL PKLRI FAD H SI+ RL TLETCCGY Y+ R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = -2 Query: 304 RSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXR 176 +S +PIL PKLRI FAD H SI+ RL TLETCCGY Y+ R Sbjct: 36 QSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 52.8 bits (121), Expect = 2e-07 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -1 Query: 305 PVXRANPYSEVTDPICRFPY-SLFYRLEALHLGDLLRIWV 189 P RANP+ EVTD CR P +LFY+ EA HLGDLLR+ V Sbjct: 77 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLV 116 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -1 Query: 305 PVXRANPYSEVTDPICRFPY-SLFYRLEALHLGDLLR 198 P RANP+ EVTD CR P +LFY+ EA HLGDLLR Sbjct: 37 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLR 73 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 49.2 bits (112), Expect = 3e-06 Identities = 30/74 (40%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = -2 Query: 328 FPSKPDTPRSSEPILIPKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSP 152 F ++ P + P +LRI FAD H SI+ RL TLETCCGY Y+ R SP Sbjct: 1 FSARQTQPLEANPFS-RRLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSP 57 Query: 151 EFSRSAESIRTPRK 110 F + + RTP++ Sbjct: 58 NFQGPSRAHRTPQE 71 >SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGAL 98 RL TLETCCGY Y+ R SP+F + + RTP+KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSM--SSPKFQGPSRAHRTPQKCGAL 41 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -2 Query: 274 LRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 LRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 54 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -2 Query: 274 LRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 LRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 54 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -2 Query: 274 LRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 LRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 2 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 55 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -2 Query: 274 LRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 LRI FAD H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 54 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 46.0 bits (104), Expect = 3e-05 Identities = 32/68 (47%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = -2 Query: 274 LRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESI-RTPRKCGA 101 LRI FAD H SI+ RL TLETCCGY Y+ R SP F + ES T R Sbjct: 1 LRIYFADFPYLHVSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGAVESAPDTTRSVVL 58 Query: 100 LRVPNHIS 77 R N IS Sbjct: 59 YRALNPIS 66 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -2 Query: 268 IQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 I FAD H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 4 IYFADFPYLHVSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 55 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -2 Query: 268 IQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 I FAD H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 10 IYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 61 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -2 Query: 280 PKLRIQFAD-SLTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 P++ FAD H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 45 PEVTDLFADFPYLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 100 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 305 PVXRANPYSEVTDPICRFPY 246 P RANP+ EVTD FPY Sbjct: 37 PTLRANPFPEVTDLFADFPY 56 >SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/48 (43%), Positives = 28/48 (58%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALRVPNH 83 RL TLETCCGY Y+ R SP F + + RTP++ G +R +H Sbjct: 1 RLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMRPYDH 46 >SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/48 (43%), Positives = 28/48 (58%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALRVPNH 83 RL TLETCCGY Y+ R SP F + + RTP++ G +R +H Sbjct: 1 RLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMRPYDH 46 >SB_54855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/40 (50%), Positives = 26/40 (65%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKC 107 RL TLETCCGY Y+ R + SP+FS + + RT +KC Sbjct: 1 RLLTLETCCGYEYDRTR--KIMSSPKFSGPSRAHRTHKKC 38 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = -2 Query: 250 LTHYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 L H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 56 LLHCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 100 Score = 31.5 bits (68), Expect = 0.63 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 305 PVXRANPYSEVTDPICRFP 249 P RANP+ EVTD CR P Sbjct: 37 PTLRANPFPEVTDLFCRLP 55 >SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALR 95 RL TLETCCGY Y+ R SP F + + RTP++ G +R Sbjct: 1 RLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 42 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALR 95 RL TLETCCGY Y+ R SP F + + RTP++ G +R Sbjct: 74 RLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 115 >SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALR 95 RL TLETCCGY Y+ R SP F + + RTP++ G +R Sbjct: 1 RLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 42 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALR 95 RL TLETCCGY Y+ R SP F + + RTP++ G +R Sbjct: 112 RLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 153 >SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALR 95 RL TLETCCGY Y+ R SP F + + RTP++ G +R Sbjct: 1 RLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 42 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = -2 Query: 244 HYSID*RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRK 110 H SI+ RL TLETCCGY Y+ R SP F + + RTP++ Sbjct: 162 HCSINQRLLTLETCCGYEYDRTRKSM--SSPNFQGPSRAHRTPQE 204 Score = 34.3 bits (75), Expect = 0.089 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 305 PVXRANPYSEVTDPICRFPY 246 P RANP+ EVTD CR PY Sbjct: 141 PTLRANPFPEVTDLFCRLPY 160 >SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = -2 Query: 226 RLFTLETCCGYGYEPXRHLXVHPSPEFSRSAESIRTPRKCGALR 95 RL TLETCCGY Y+ R SP F + + RTP++ G +R Sbjct: 1 RLLTLETCCGYEYDRTRKSM--SSPNFRGPSRAHRTPQETGRMR 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,811,087 Number of Sequences: 59808 Number of extensions: 430176 Number of successful extensions: 2967 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2003 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -