BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021390 (659 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL161954-1|CAB82305.1| 110|Homo sapiens hypothetical protein pr... 30 6.4 AB033092-1|BAA86580.1| 601|Homo sapiens KIAA1266 protein protein. 30 6.4 >AL161954-1|CAB82305.1| 110|Homo sapiens hypothetical protein protein. Length = 110 Score = 30.3 bits (65), Expect = 6.4 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -2 Query: 175 HLXVHPS--PEFSRSAESIRTPRKCGALRVPNHISL 74 +L +HP+ P RS S++TP L PNH SL Sbjct: 52 YLEIHPAKKPNVIRSTPSLQTPTTKRMLTTPNHTSL 87 >AB033092-1|BAA86580.1| 601|Homo sapiens KIAA1266 protein protein. Length = 601 Score = 30.3 bits (65), Expect = 6.4 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -2 Query: 175 HLXVHPS--PEFSRSAESIRTPRKCGALRVPNHISL 74 +L +HP+ P RS S++TP L PNH SL Sbjct: 543 YLEIHPAKKPNVIRSTPSLQTPTTKRMLTTPNHTSL 578 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,666,445 Number of Sequences: 237096 Number of extensions: 2044070 Number of successful extensions: 4897 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4897 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7422585720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -