BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021387 (680 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D42053-1|BAA07653.2| 1058|Homo sapiens KIAA0091 protein. 66 1e-10 BC114961-1|AAI14962.1| 1052|Homo sapiens membrane-bound transcri... 66 1e-10 BC114555-1|AAI14556.1| 1052|Homo sapiens membrane-bound transcri... 66 1e-10 >D42053-1|BAA07653.2| 1058|Homo sapiens KIAA0091 protein. Length = 1058 Score = 66.1 bits (154), Expect = 1e-10 Identities = 25/64 (39%), Positives = 47/64 (73%) Frame = +3 Query: 255 VQYEXTDVVKSQHIITFKGYYPRSTRENYVNAALTSAGITDWKIIKRNNPAKEYPSDFDV 434 V++ T VV+ ++I+ F GY+ R +++++AL S+ + +W+II RNNP+ +YPSDF+V Sbjct: 51 VEFSST-VVEYEYIVAFNGYFTAKARNSFISSALKSSEVDNWRIIPRNNPSSDYPSDFEV 109 Query: 435 VVLE 446 + ++ Sbjct: 110 IQIK 113 >BC114961-1|AAI14962.1| 1052|Homo sapiens membrane-bound transcription factor peptidase, site 1 protein. Length = 1052 Score = 66.1 bits (154), Expect = 1e-10 Identities = 25/64 (39%), Positives = 47/64 (73%) Frame = +3 Query: 255 VQYEXTDVVKSQHIITFKGYYPRSTRENYVNAALTSAGITDWKIIKRNNPAKEYPSDFDV 434 V++ T VV+ ++I+ F GY+ R +++++AL S+ + +W+II RNNP+ +YPSDF+V Sbjct: 45 VEFSST-VVEYEYIVAFNGYFTAKARNSFISSALKSSEVDNWRIIPRNNPSSDYPSDFEV 103 Query: 435 VVLE 446 + ++ Sbjct: 104 IQIK 107 >BC114555-1|AAI14556.1| 1052|Homo sapiens membrane-bound transcription factor site-1 protease, isoform 1 preproprotein protein. Length = 1052 Score = 66.1 bits (154), Expect = 1e-10 Identities = 25/64 (39%), Positives = 47/64 (73%) Frame = +3 Query: 255 VQYEXTDVVKSQHIITFKGYYPRSTRENYVNAALTSAGITDWKIIKRNNPAKEYPSDFDV 434 V++ T VV+ ++I+ F GY+ R +++++AL S+ + +W+II RNNP+ +YPSDF+V Sbjct: 45 VEFSST-VVEYEYIVAFNGYFTAKARNSFISSALKSSEVDNWRIIPRNNPSSDYPSDFEV 103 Query: 435 VVLE 446 + ++ Sbjct: 104 IQIK 107 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,811,823 Number of Sequences: 237096 Number of extensions: 2265817 Number of successful extensions: 3970 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3970 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7727256732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -