BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021387 (680 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032641-3|CAA21648.1| 200|Caenorhabditis elegans Hypothetical ... 28 7.1 Z92803-10|CAB07246.1| 449|Caenorhabditis elegans Hypothetical p... 27 9.4 >AL032641-3|CAA21648.1| 200|Caenorhabditis elegans Hypothetical protein Y5F2A.3 protein. Length = 200 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 333 ENYVNAALTSAGITDWKIIKRNNPAKEY 416 +NY+NA++TS + K I +P KEY Sbjct: 135 KNYINASITSCPPCERKWIVAQHPMKEY 162 >Z92803-10|CAB07246.1| 449|Caenorhabditis elegans Hypothetical protein K01G5.7 protein. Length = 449 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/44 (25%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -2 Query: 676 SGAGQPVIVCGRVPHGHEFSKRVQSLFAIIPPPRI-QTAPDPHH 548 +G+G ++ ++ EF R+ S F+++P P++ T +P++ Sbjct: 143 TGSGMGTLLISKIRE--EFPDRIMSSFSVVPSPKVSDTVVEPYN 184 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,180,424 Number of Sequences: 27780 Number of extensions: 350820 Number of successful extensions: 960 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -