BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021384 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosec... 24 1.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.2 AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. 24 1.2 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 4.7 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 8.2 >M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosecapin mRNA, complete cds. ). Length = 77 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 326 ARTGDRGPQRLRYVLDELVHCGRGSGCVPQRC 421 AR+ D P+ RY++D C GS + RC Sbjct: 42 ARSADLVPEP-RYIIDVPPRCPPGSKFIKNRC 72 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 359 RYVLDELVHCGRGSGCVPQRCSSSRIGMGVRG 454 R++ +EL HC C P S G+ RG Sbjct: 1686 RHMYEELNHCAPNRRCPPPPRMGSAEGLSHRG 1717 >AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. Length = 77 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 326 ARTGDRGPQRLRYVLDELVHCGRGSGCVPQRC 421 AR+ D P+ RY++D C GS + RC Sbjct: 42 ARSADLVPEP-RYIIDVPPRCPPGSKFIKNRC 72 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +3 Query: 327 PGQATVVLNVYDMYWTNW 380 PG + V Y +YW W Sbjct: 557 PGSNSAVFTNYKLYWRYW 574 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 373 RIGTLRARVWVCSTAV 420 R L A VW+CS+A+ Sbjct: 162 RAAVLIAIVWICSSAI 177 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 255 CGICAMFPSCMSLLSRRSDSQHPRPGQATVVLNVYDMYWT 374 C +C S L R + QH +P + V + ++ T Sbjct: 374 CDVCGKTLSTKLTLKRHKEQQHFQPLNSAVCALCHKVFRT 413 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,562 Number of Sequences: 438 Number of extensions: 4401 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -