BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021382 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 27 0.42 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 3.9 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 27.5 bits (58), Expect = 0.42 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +3 Query: 243 SK*RVTTEPEELAANGGPTSSSDVLDVETSIAPPAQEEHPVVEQG 377 SK T P++ G P SSS + ++ S +P + +QG Sbjct: 1440 SKESAATRPKDQPGGGSPASSSGMAILDMSASPKMYSFRRIAQQG 1484 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 413 FIYVHFIFSICITLFNYRMLFLSRRCN 333 F VH IF +C++L N+ +RR N Sbjct: 529 FGVVHMIFGVCMSLVNHN--HFNRRVN 553 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,588 Number of Sequences: 2352 Number of extensions: 11649 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -