BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021381 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 67 1e-11 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 58 7e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 57 2e-08 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 44 9e-05 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 44 2e-04 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 42 6e-04 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 42 6e-04 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 39 0.004 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 38 0.010 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 37 0.018 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 36 0.024 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 36 0.024 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 36 0.024 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 35 0.055 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 35 0.073 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 34 0.096 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.22 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_29985| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 30 1.6 SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) 29 2.7 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 6.3 SB_8293| Best HMM Match : zf-C2H2 (HMM E-Value=0.32) 28 6.3 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 8.4 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 70.5 bits (165), Expect = 1e-12 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 672 +TGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI A FG Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFG 614 Score = 41.1 bits (92), Expect = 8e-04 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +2 Query: 257 QPFNKNFYDPHPTVLKXSPYEVEEYRNNXGI 349 +PFNKNFY+ HP + K S E+++ R GI Sbjct: 475 KPFNKNFYEEHPEITKQSKQEIDDLRKKMGI 505 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 Query: 375 PIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG 509 P F F + + ++ + Y +PT IQ Q PIA+SG++++G Sbjct: 515 PCISFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIG 559 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 541 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 672 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA G Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVG 156 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = +3 Query: 375 PIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 470 P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 81 PVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 58.0 bits (134), Expect = 7e-09 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 4/57 (7%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFG 672 +TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ FG Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFG 202 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/45 (42%), Positives = 31/45 (68%) Frame = +3 Query: 375 PIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG 509 PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++G Sbjct: 99 PIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIG 143 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 648 +TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ+ Sbjct: 117 ETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 375 PIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG 509 PI+ F + N P + + ++ PTPIQ Q MSG++++G Sbjct: 70 PIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLSCVMSGRDIIG 114 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/56 (50%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HT 678 QTGSGKT AY+LP + + Q P+AL +APTRELA+QI A F HT Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHT 579 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 Query: 378 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 I F E F + + + GY+ PTP+Q PI M+G++L+ Sbjct: 478 ITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLM 520 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 46.4 bits (105), Expect = 2e-05 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSYVS 690 Q+G+GKT + + + I+ + G D ALVLAPTRELAQQIQ+V G +V Sbjct: 130 QSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVK 189 Query: 691 *H 696 H Sbjct: 190 CH 191 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH 675 QTGSGKT A++LP + + N P A+ +APTRELA QI A F H Sbjct: 756 QTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAH 813 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/49 (34%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = +3 Query: 369 HNPIQY---FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 +NP+++ FEEAN + V+ YK+PTP+Q PI ++G++++ Sbjct: 704 NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVM 752 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/46 (45%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQI 648 +TG+GKTL++ LP + + + + +RG P LV+APTRELA+Q+ Sbjct: 118 RTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQV 163 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/54 (46%), Positives = 34/54 (62%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH 675 +TGSGKTLA+++P I + Q DG ALV++PTRELA Q +V G+ Sbjct: 95 KTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIGN 147 Score = 34.3 bits (75), Expect = 0.096 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 378 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVG 509 ++ F + G+ G+ PT IQ QG P+A+SG++++G Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLG 92 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 381 QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGY 512 Q E FPDY+ V+ GY PTPIQ Q P+ G G+ Sbjct: 163 QLIERYGFPDYIIHNVQERGYTTPTPIQMQATPLMAHGPKKSGF 206 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +1 Query: 541 YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 648 Y P + + P + G G A+V++PTRELAQQI Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 41.5 bits (93), Expect = 6e-04 Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 5/59 (8%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGH 675 QTGSGKTLAY+ P +VH + R G P A ++ P RELA QI + A H Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCH 480 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/61 (42%), Positives = 35/61 (57%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVS* 693 Q+G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V G V Sbjct: 42 QSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALGDYMSVQC 96 Query: 694 H 696 H Sbjct: 97 H 97 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/51 (39%), Positives = 34/51 (66%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD 666 +TGSGKTLA+++P +V + + + +G ++++PTREL+ Q VA D Sbjct: 617 KTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARD 666 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/49 (34%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = +3 Query: 369 HNPIQY---FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 +NP+++ FEEAN + V+ YK+PTP+Q PI ++G++++ Sbjct: 127 NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVM 175 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 37.9 bits (84), Expect = 0.008 Identities = 21/53 (39%), Positives = 30/53 (56%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 672 +TGSGKT A+++P + G AL+L+PTRELA Q Q+ + G Sbjct: 326 RTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELG 375 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 37.5 bits (83), Expect = 0.010 Identities = 22/45 (48%), Positives = 28/45 (62%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 648 +TGSGKT A+ LP + + + P G A+VL PTRELA QI Sbjct: 52 KTGSGKTAAFALPILQKLCDDP-----YGIFAVVLTPTRELAFQI 91 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 36.7 bits (81), Expect = 0.018 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +3 Query: 372 NPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 +P+ F +F + + + + GY PTPIQ Q P+ +SG++++ Sbjct: 193 SPVLEFFHCSFNESLSKNLSNHGYHSPTPIQMQVLPVLLSGRDVM 237 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 36.3 bits (80), Expect = 0.024 Identities = 22/53 (41%), Positives = 29/53 (54%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 672 +TGSGKT A+ LP + + + P AL+L PTRELA QI + G Sbjct: 9 ETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALG 56 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 672 + G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 92 KNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/40 (27%), Positives = 25/40 (62%) Frame = +3 Query: 387 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 FE+ + G+ G+ +P+PIQ + P+A++G++++ Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDIL 88 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 672 + G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 92 KNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/40 (27%), Positives = 25/40 (62%) Frame = +3 Query: 387 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 FE+ + G+ G+ +P+PIQ + P+A++G++++ Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDIL 88 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = +3 Query: 375 PIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 P++ + + + +K Y++PTPIQAQ P+ MSG++++ Sbjct: 103 PVKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMI 146 Score = 31.5 bits (68), Expect = 0.68 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +1 Query: 529 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF 669 K +Y P + P I G IA+V+ PTRELA QI + F Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKF 167 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 257 QPFNKNFYDPHPTVLKXSPYEVEEYR 334 QPF K+FY P + K +P E +E+R Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFR 87 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 35.9 bits (79), Expect = 0.032 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 14/60 (23%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLAPTRELAQQIQ 651 +TGSGKTLA+ +P I HI Q P +G +AL++APTRELA Q++ Sbjct: 176 ETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQVK 235 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 35.1 bits (77), Expect = 0.055 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +1 Query: 511 TQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYV 687 ++TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q + +V+ G S V Sbjct: 204 SETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQMLYEVSRLLGDKSIV 255 Query: 688 S 690 + Sbjct: 256 A 256 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 34.7 bits (76), Expect = 0.073 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +1 Query: 511 TQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 672 +Q+G+GKT A++L + ++ P P + L+PT ELA+Q +VA G Sbjct: 149 SQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMG 197 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 34.3 bits (75), Expect = 0.096 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +1 Query: 601 PIALVLAPTRELAQQIQQVAADFGHTSYVS*H 696 P ALVL+PTRELA QIQ+V G V H Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDYMSVQCH 35 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 517 TGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 645 TG+GKT A++LP + + +P + LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 420 QGVKTMGYKEPTPIQAQGWPIAMSGKNL 503 + V +G+ PTPIQA P+A+ GK++ Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDV 50 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 378 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 I FE+ + + + V GYK+PTP+Q PI ++L+ Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLM 916 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPP 582 QTGSGKT A+++P + I + P Sbjct: 920 QTGSGKTAAFLIPILSRIYMEGP 942 >SB_29985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 425 CKDNGLQRTDAYSSSRLADSYVWKEFS--WVLKRV--PAKRWPTSCQPL 559 C D TD S +++ D +W+EF+ WVL RV P+ SC + Sbjct: 125 CPDVMYYTTDYSSETKMRDKAIWREFATKWVLVRVALPSVTHSFSCSDI 173 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +1 Query: 520 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAAD 666 GSGK LAY+LP I I + +GP+ L+L + ++ V D Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCED 285 >SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) Length = 910 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = -2 Query: 470 LSLNRRRFFVTHCLYTLLHIIRK-ICFFKVLNRIMNLNATYRYLXYFCTLRLHMVXF*EL 294 L ++++RF L H R+ C + LNR ++ ++ ++C LH +L Sbjct: 192 LHISKKRFSTHINLLLYSHGERRHYCLIRNLNRFLSRQTKHKGRMFYCPFCLHGFVRQDL 251 Query: 293 *DVDHKSFC*KVG*NRIPI 237 D DH+ C + G RI + Sbjct: 252 LD-DHQLLCSQHGAQRIEL 269 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = +3 Query: 369 HNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 476 H P++ + FP Y + Y P P QA W Sbjct: 8 HGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +1 Query: 415 CNKV*RQWVTKNRRLFKLKAGR*LCLERI*LGTQTGSGK 531 CN+ R V K+RRL AGR L I T +GS K Sbjct: 59 CNESGRMSVDKDRRLISTSAGRVTKLPPIGAPTSSGSNK 97 >SB_8293| Best HMM Match : zf-C2H2 (HMM E-Value=0.32) Length = 316 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = -2 Query: 407 RKICFFKVLNRIMNLNATYRYLXYFCTLRLHMVXF*EL*DVDHKSFC*KVG*NRIPI 237 R C + LNR ++ ++ ++C LH +L D DH+ C + G RI + Sbjct: 146 RHYCLIRNLNRFLSRQTKHKGRMFYCLFCLHGFVRQDLLD-DHQLLCSQHGAQRIEL 201 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 225 CSDLQRILFSHQILQILQIYCHRC-QIETN 139 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 156 CQIETNYRRICCLLQIWN-HRFHGYYSS 76 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -2 Query: 473 ALSLNRRR-FFVTHCLYTLLHIIRKICFFKVLNRIMNLNATYRYLXYFCTLRL 318 ALS++ R +F T C++ L +R +C + ++++ Y YL C L Sbjct: 1702 ALSVSLRYLYFCTICVFALSVSLRYLCLCAICVFALSVSLRYLYLCAICIFAL 1754 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,566,999 Number of Sequences: 59808 Number of extensions: 386730 Number of successful extensions: 1012 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -