BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021378 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58730.1 68416.m06546 vacuolar ATP synthase subunit D (VATD) ... 79 3e-15 At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) 31 0.97 At5g15020.1 68418.m01761 paired amphipathic helix repeat-contain... 30 1.7 At3g19190.1 68416.m02436 expressed protein 29 3.0 At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 29 3.0 At5g06730.1 68418.m00761 peroxidase, putative similar to peroxid... 29 3.9 At1g73460.1 68414.m08504 protein kinase family protein contains ... 29 3.9 At1g73450.1 68414.m08503 protein kinase, putative similar to nuc... 29 3.9 At3g23910.1 68416.m03004 expressed protein 28 5.2 At5g28760.1 68418.m03532 hypothetical protein contains Pfam prof... 28 6.8 At3g01320.1 68416.m00045 paired amphipathic helix repeat-contain... 27 9.0 At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 27 9.0 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 27 9.0 >At3g58730.1 68416.m06546 vacuolar ATP synthase subunit D (VATD) / V-ATPase D subunit / vacuolar proton pump D subunit (VATPD) identical to Vacuolar ATP synthase subunit D (EC 3.6.3.14) (V-ATPase D subunit) (Vacuolar proton pump D subunit) (Swiss-Prot:Q9XGM1) [Arabidopsis thaliana] Length = 261 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%) Frame = +3 Query: 237 SCFLFGEAKFTTGD-FNQVVLQNVTKAQIKIRSKKDNVAGVTLPIFESYQDGSDTYELAG 413 S F E K+ GD VVL+NV +A +K+RS+ +N+AGV LP F+ + +G +L G Sbjct: 66 SSFALTEVKYVAGDNVKHVVLENVKEATLKVRSRTENIAGVKLPKFDHFSEGETKNDLTG 125 Query: 414 LARGGQQLAKLKKNFQSAVKLLVELA 491 LARGGQQ+ + + A+++LVELA Sbjct: 126 LARGGQQVRACRVAYVKAIEVLVELA 151 Score = 68.5 bits (160), Expect = 4e-12 Identities = 33/73 (45%), Positives = 52/73 (71%), Gaps = 1/73 (1%) Frame = +1 Query: 46 MSGKD-RLAIFPSRGAQMLIKGRLAGAVKGHGLLKKKADALQVRFRMILSKIIETKTLMG 222 M+G++ RL + P+ ++K RL GA +GH LLKKK+DAL V+FR +L KI+ K MG Sbjct: 1 MAGQNARLNVVPTVTMLGVMKARLVGATRGHALLKKKSDALTVQFRALLKKIVTAKESMG 60 Query: 223 EVMKEAAFSLAKL 261 ++MK ++F+L ++ Sbjct: 61 DMMKTSSFALTEV 73 Score = 64.1 bits (149), Expect = 9e-11 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +2 Query: 509 VTLDEVIKITNRRVNAIEHVIIPRLERTLAYIISELDELERE 634 +TLDE IK TNRRVNA+E+V+ P+LE T++YI ELDELERE Sbjct: 158 LTLDEAIKTTNRRVNALENVVKPKLENTISYIKGELDELERE 199 >At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) Length = 638 Score = 30.7 bits (66), Expect = 0.97 Identities = 21/74 (28%), Positives = 37/74 (50%) Frame = +3 Query: 264 FTTGDFNQVVLQNVTKAQIKIRSKKDNVAGVTLPIFESYQDGSDTYELAGLARGGQQLAK 443 F D + Q + Q ++ +VAG +P++ES S+ + G + GG+ L Sbjct: 46 FDRSDSPNLTTQQKQEHQRVEMDEESSVAGGRIPVYESAGMLSEMFNFPGSSGGGRDL-D 104 Query: 444 LKKNFQSAVKLLVE 485 L ++F+S +LL E Sbjct: 105 LGQSFRSNRQLLEE 118 >At5g15020.1 68418.m01761 paired amphipathic helix repeat-containing protein similar to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 1377 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -3 Query: 535 DLNNLVE-SDNEVCSDANSTKSFTALWKFFLSFASCCPPRAKPANS 401 DL LV+ S E+CS T LW FL PRAK ++S Sbjct: 736 DLFKLVQFSCEEICSTKEQTGKVLKLWANFLELMLDVAPRAKGSDS 781 >At3g19190.1 68416.m02436 expressed protein Length = 1861 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -3 Query: 505 EVCSDANSTKSFTALWKFFLSFASCCPPRAKPANS*VSEPSWYDSKIGRVTPATLS 338 EV ++ + F LWK F SF S C P ++ P+ + + PATLS Sbjct: 309 EVRFQPSTIRWFLQLWKTFTSFGSDCFPSVSHSDFLTDSPT-IPTNVMVTPPATLS 363 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -3 Query: 577 GNDYVLNGVDTSIRDLNNLVESDNEVCSDANSTKSFTA-LWKFFLSFASCCPPRAKPANS 401 G +++ ++T L +L + + ++ S A LW+ F +C P PANS Sbjct: 408 GPQHLVADLETCSLHLKHLAAAAKDAVAEGGSVPGCRARLWRRIREFNACIPYTGVPANS 467 Query: 400 *VSE 389 V E Sbjct: 468 EVPE 471 >At5g06730.1 68418.m00761 peroxidase, putative similar to peroxidase [Arabidopsis thaliana] gi|1491617|emb|CAA68212 Length = 358 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 574 NDYVLNGVDTSIR-DLNNLVESDNEVCSDANSTKSFTALWKFFLSFASCCP 425 +D +NG D S+ D + ++S+ ++ANST+ F + + + CP Sbjct: 73 HDCFVNGCDGSLLLDDTSSIQSEKNAPANANSTRGFNVVDSIKTALENACP 123 >At1g73460.1 68414.m08504 protein kinase family protein contains protein kinase domain Pfam:PF00069 Length = 1169 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 175 FRMILSKIIETKTLMGEVMKEAAFSLAKLSSQLETSTKLCYKMLPRLK 318 F ++L+ +I + + E + AAFS A + L+T +C K++ K Sbjct: 846 FNVVLNSVIAGRYHVTEYLGSAAFSKAIQAHDLQTGMDVCIKIIKNNK 893 >At1g73450.1 68414.m08503 protein kinase, putative similar to nuclear serine/threonine protein kinase GI:3582644 from [Rattus norvegicus] Length = 1152 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 175 FRMILSKIIETKTLMGEVMKEAAFSLAKLSSQLETSTKLCYKMLPRLK 318 F ++L+ +I + + E + AAFS A + L+T +C K++ K Sbjct: 829 FNVVLNSVIAGRYHVTEYLGSAAFSKAIQAHDLQTGMDVCIKIIKNNK 876 >At3g23910.1 68416.m03004 expressed protein Length = 421 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/70 (22%), Positives = 31/70 (44%) Frame = +2 Query: 446 QEELPERCEAFGRVSVTADFIVTLDEVIKITNRRVNAIEHVIIPRLERTLAYIISELDEL 625 +EE E C + V DF++ + +K ++ + + + L Y+ +EL + Sbjct: 30 REEPVESCSSDYETLVVQDFVLQFEPKVKEIVEEYGDVDLLDVEDSDAYLEYLRNELQSV 89 Query: 626 EREGVLPSQE 655 E E S+E Sbjct: 90 EAESAKVSEE 99 >At5g28760.1 68418.m03532 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 520 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 622 LVQLGDDVRECTFQPGNDYVLNGVDTSIRDLNNLVESD 509 L ++ DDV C P + +G I+D++++VE D Sbjct: 292 LQKIVDDVHACETFPWGRFTFDGCMEGIKDISSIVEYD 329 >At3g01320.1 68416.m00045 paired amphipathic helix repeat-containing protein low similarity to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 1378 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 535 DLNNLVE-SDNEVCSDANSTKSFTALWKFFLSFASCCPPRAK 413 D+ +V+ S E+CS LW+ FL PPRAK Sbjct: 713 DMFKVVQFSCEELCSTKEQLSKVLRLWENFLEAVLGVPPRAK 754 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 3/91 (3%) Frame = +1 Query: 85 GAQMLIKGRLAGAVKGHGLLKKKADALQVRFRMILSKIIETKTL-MGEVMKEAAFSLAKL 261 GA+ L K R K +GLL K + ++R ++L IE K L + ++ + + Sbjct: 693 GAEFLSKKRTDSLKKINGLLAKNLERKRIRPDLVLRLQIEEKKLRLSDLQSRVREEVDRQ 752 Query: 262 SSQLETSTKLCYKMLPRL--KSRLGPRRTML 348 ++ + Y+ RL + RL R +L Sbjct: 753 QQEIMSMPDRPYRKFVRLCERQRLEMNRQVL 783 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 3/91 (3%) Frame = +1 Query: 85 GAQMLIKGRLAGAVKGHGLLKKKADALQVRFRMILSKIIETKTL-MGEVMKEAAFSLAKL 261 GA+ L K R K +GLL K + ++R ++L IE K L + ++ + + Sbjct: 693 GAEFLSKKRTDSLKKINGLLAKNLERKRIRPDLVLRLQIEEKKLRLSDLQSRVREEVDRQ 752 Query: 262 SSQLETSTKLCYKMLPRL--KSRLGPRRTML 348 ++ + Y+ RL + RL R +L Sbjct: 753 QQEIMSMPDRPYRKFVRLCERQRLEMNRQVL 783 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,254,972 Number of Sequences: 28952 Number of extensions: 289250 Number of successful extensions: 862 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -