BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021376 (674 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03340.1 68418.m00286 cell division cycle protein 48, putativ... 119 2e-27 At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)... 119 2e-27 At3g53230.1 68416.m05865 cell division cycle protein 48, putativ... 113 8e-26 At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak... 31 0.93 At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containi... 30 1.2 At1g69710.1 68414.m08022 zinc finger protein, putative / regulat... 29 2.8 At3g10160.1 68416.m01218 dihydrofolate synthetase/folylpolygluta... 28 5.0 At4g38750.1 68417.m05488 expressed protein 28 6.6 At5g10520.1 68418.m01218 protein kinase family protein contains ... 27 8.7 At5g05980.1 68418.m00662 dihydrofolate synthetase/folylpolygluta... 27 8.7 At1g49400.1 68414.m05537 ribosomal protein S17 family protein si... 27 8.7 At1g10180.1 68414.m01148 expressed protein 27 8.7 >At5g03340.1 68418.m00286 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; supporting cDNA gi|26449351|dbj|AK117125.1| Length = 810 Score = 119 bits (286), Expect = 2e-27 Identities = 51/99 (51%), Positives = 67/99 (67%) Frame = +2 Query: 221 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 400 L +G+ + CI L+D+ C + KIRM DV+S+ CP VKYGKRVHIL Sbjct: 62 LIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHIL 121 Query: 401 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMSAG 517 P+DD+VEG+TGNLF+ YLKPYF+EAYRP+ + D F+ G Sbjct: 122 PVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRG 160 Score = 93.9 bits (223), Expect = 9e-20 Identities = 42/65 (64%), Positives = 55/65 (84%) Frame = +3 Query: 60 ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 239 +D+K+ D STAIL RK PNRL+V+EA++DDNSVV+L ME+LQLFRGDT+L+KGK+ Sbjct: 8 SDSKTKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKK 67 Query: 240 RKETV 254 RK+TV Sbjct: 68 RKDTV 72 Score = 92.7 bits (220), Expect = 2e-19 Identities = 39/55 (70%), Positives = 49/55 (89%) Frame = +1 Query: 508 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGG 672 VRGGMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+EE L+ VGYDD+GG Sbjct: 158 VRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDEER-LDEVGYDDVGG 211 >At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A) (CDC48) identical to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana} Length = 809 Score = 119 bits (286), Expect = 2e-27 Identities = 51/99 (51%), Positives = 67/99 (67%) Frame = +2 Query: 221 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 400 L +G+ + CI L+D+ C + KIRM DV+S+ CP VKYGKRVHIL Sbjct: 62 LIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHIL 121 Query: 401 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMSAG 517 P+DD+VEG+TGNLF+ YLKPYF+EAYRP+ + D F+ G Sbjct: 122 PVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRG 160 Score = 96.7 bits (230), Expect = 1e-20 Identities = 44/65 (67%), Positives = 56/65 (86%) Frame = +3 Query: 60 ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 239 +D+KS D STAIL RK PNRL+V+EA++DDNSVV+L A ME+LQLFRGDT+L+KGK+ Sbjct: 8 SDSKSKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKK 67 Query: 240 RKETV 254 RK+TV Sbjct: 68 RKDTV 72 Score = 92.3 bits (219), Expect = 3e-19 Identities = 39/55 (70%), Positives = 49/55 (89%) Frame = +1 Query: 508 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGG 672 VRGGMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+EE L+ VGYDD+GG Sbjct: 158 VRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDEER-LDDVGYDDVGG 211 >At3g53230.1 68416.m05865 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain Length = 815 Score = 113 bits (273), Expect = 8e-26 Identities = 47/99 (47%), Positives = 66/99 (66%) Frame = +2 Query: 221 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 400 L +G+ + CI L+D+ C + KIRM DV+S+ CP VKYG RVHIL Sbjct: 63 LIKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVHIL 122 Query: 401 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMSAG 517 P+DD++EG++GN+F+ YLKPYF+EAYRP+ + D F+ G Sbjct: 123 PLDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLVRG 161 Score = 92.7 bits (220), Expect = 2e-19 Identities = 39/55 (70%), Positives = 49/55 (89%) Frame = +1 Query: 508 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGG 672 VRGGMR++EFKV+ETDP+ +C+VAPDT I C+GEPIKRE+EE L+ VGYDD+GG Sbjct: 159 VRGGMRSIEFKVIETDPAEYCVVAPDTEIFCEGEPIKREDEER-LDEVGYDDVGG 212 Score = 84.2 bits (199), Expect = 7e-17 Identities = 40/66 (60%), Positives = 54/66 (81%), Gaps = 1/66 (1%) Frame = +3 Query: 60 ADNK-SPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 236 +D+K + D STAIL +K NRL+V+EA++DDNSVV+L ME+LQLFRGDT+L+KGK Sbjct: 8 SDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDTILIKGK 67 Query: 237 RRKETV 254 +RK+TV Sbjct: 68 KRKDTV 73 >At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak similarity to Pfam domain PF01612: 3'-5' exonuclease Length = 263 Score = 30.7 bits (66), Expect = 0.93 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -1 Query: 212 TTEELKLLHFGL*KCHD*VVIAD 144 TTEELK+ H+ L KC D +V+A+ Sbjct: 3 TTEELKISHYKLYKCFDFLVVAN 25 >At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 455 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 367 RTRSDGYHIRKTHTKVVSHNTVHPNFLIRAII 272 RT S+ +++ HTK++ HN + L+R +I Sbjct: 28 RTCSNFSQLKQIHTKIIKHNLTNDQLLVRQLI 59 >At1g69710.1 68414.m08022 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1028 Score = 29.1 bits (62), Expect = 2.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 462 TSWRLTVRSIVTTPSCPRGHARR 530 + W+ T++ +T+ CP HARR Sbjct: 127 SKWKTTIKPEITSAECPTPHARR 149 >At3g10160.1 68416.m01218 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS3) nearly identical to gi:17976757 Length = 464 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 540 FELDGAHAPADMKVSSRW 487 F LDGAH+P M+ RW Sbjct: 250 FYLDGAHSPESMEACGRW 267 >At4g38750.1 68417.m05488 expressed protein Length = 1073 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/55 (23%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 357 LRVLQ*NMENESTYCQLMIQLRVLLAI--YSKYT*SRTSWRLTVRSIVTTPSCPR 515 +++++ +EN+ + ++ L+ +LA Y KY W++T++ I +C R Sbjct: 1 MQLVEGGLENDVVFALVVFSLQYILASHEYWKYNHGNMRWKVTLKVIELMKTCLR 55 >At5g10520.1 68418.m01218 protein kinase family protein contains protein kinase domain, INTERPRO:IPR000719 Length = 467 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 55 KWQIIKALMIYR-PRSSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNF 198 ++ +I L Y R ++ R P L+ +SA T +++ +P W NF Sbjct: 95 RFSVIPLLASYELTRKNLRRKQP--KLTPSESAFTCEAFFMAKPSWRNF 141 >At5g05980.1 68418.m00662 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS2) nearly identical to gi:17976705; identical to cDNA dihydrofolate synthetase/folylpolyglutamate synthetase (dhfs/fpgs2 gene) GI:17976704 Length = 571 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 540 FELDGAHAPADMKVSSRW 487 F LDGAH+P M+ ++W Sbjct: 382 FYLDGAHSPESMEACAKW 399 >At1g49400.1 68414.m05537 ribosomal protein S17 family protein similar to 40S ribosomal protein S17 GI:1620985 from [Nicotiana plumbaginifolia] Length = 116 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +1 Query: 34 SNNKF*IKWQIIKALMIYRPRSSVARTDPTVSLSKKQSAMTTQS 165 S NK I +IIK IY P+++ A + S S SA TT S Sbjct: 64 SKNKHWIVAEIIKKARIYSPKAAAAAVSASASAS---SASTTDS 104 >At1g10180.1 68414.m01148 expressed protein Length = 769 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +3 Query: 180 AKMEQLQLFRGDTVLLKGKRRKETVASCSQTII 278 +K++QL + GD +L K K +K +A ++T+I Sbjct: 576 SKLQQLAIIAGDVLLGKEKLQKILLARLTETVI 608 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,693,584 Number of Sequences: 28952 Number of extensions: 307989 Number of successful extensions: 858 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -