BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021372 (542 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 5.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 5.3 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 5.3 Identities = 9/51 (17%), Positives = 23/51 (45%) Frame = +2 Query: 332 VTNEFNGEYAAKQYLTXFEQELEEKYYDTEKIPVPLLVAKMSQLHLEVYTQ 484 +TN++ A K + + E + ++P L K + ++++Y + Sbjct: 305 LTNDWEDHLAVKHFSVEGQLEFRALLFVPRRVPFDLFENKKRKNNIKLYVR 355 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -2 Query: 427 YLLCVIILFLQFLLEXSQILLC 362 +LLC+ F F++ +L C Sbjct: 162 FLLCIYHFFCAFIIFTMHLLFC 183 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,880 Number of Sequences: 336 Number of extensions: 2476 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -