BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021366 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transf... 26 1.3 AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 25 2.3 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 24 4.0 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 5.3 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 9.2 >L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 619 SKSKLTCNVGFDVAMEVYKMRWNGKPLHFL 530 S+S L CN+ D + + ++ G+PL FL Sbjct: 7 SRSSLKCNIMPDYKVYYFNVKALGEPLRFL 36 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 495 QSQHGRPLFWNGRKWSGFPF 554 Q Q G P F NG++ FPF Sbjct: 147 QGQSGFPSFGNGQQGGNFPF 166 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 24.2 bits (50), Expect = 4.0 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = -2 Query: 344 IGPKIKTMASCI------KANVWHAFQGPKIEPSLIYAEF 243 +G + T+ C+ K + W ++ P +EP L Y F Sbjct: 11 LGVLLATLCLCVYLLVVRKYSFWRSYHVPYVEPELPYGNF 50 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 370 SKDRPPNLFVYGGQT 414 S+D PP LFV G QT Sbjct: 1106 SRDLPPFLFVRGNQT 1120 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -2 Query: 440 RSKPRET-YGVWPPYTNKLGGRSLLSKTR 357 R P +T Y WPPY + G L S R Sbjct: 700 RGAPTDTEYESWPPYDYEAPGVQLNSLNR 728 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,145 Number of Sequences: 2352 Number of extensions: 15725 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -