BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021364 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 25 0.79 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 25 0.79 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 1.8 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 22 4.2 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 22 4.2 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 9.7 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 24.6 bits (51), Expect = 0.79 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 151 PFSTIKLHNVHKKSNYNNNKTTI 83 P STI L+N SN+N + +++ Sbjct: 40 PSSTIDLYNTSSVSNFNESSSSV 62 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 24.6 bits (51), Expect = 0.79 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 151 PFSTIKLHNVHKKSNYNNNKTTI 83 P STI L+N SN+N + +++ Sbjct: 40 PSSTIDLYNTSSVSNFNESSSSV 62 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +2 Query: 275 FTCLQTKMVKEKPNSIRIYDDEGFRRRAACICVRSDA 385 F + K K PN + YD R+ IC DA Sbjct: 199 FFLAEFKSAKTPPNKLNCYDLRRVRKNYNSICELVDA 235 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 573 LGSRILQDIVLVSRSLRLPQV 511 +G + +IVLV S R+P+V Sbjct: 154 IGKSAVHEIVLVGGSTRIPKV 174 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 573 LGSRILQDIVLVSRSLRLPQV 511 +G + +IVLV S R+P+V Sbjct: 154 IGKSAVHEIVLVGGSTRIPKV 174 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 139 IKLHNVHKKSNYNNNKTTIR 80 +KL NV NY N +T R Sbjct: 114 VKLQNVSLIINYENQRTRSR 133 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,167 Number of Sequences: 336 Number of extensions: 3318 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -