BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021360 (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_9365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_56504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +1 Query: 346 SLNVSISMSTHSFPTRLKLSSKRTQMFVPXGGTLLSAYFQKLSIKSTK 489 +L SI+ S SFPT L LS K + P G + + K S+K K Sbjct: 33 ALQASIATSKASFPTPLSLSQKNAKAVKPSGNSTSTQTELKSSMKIRK 80 >SB_9365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 530 LMHDAIVLIFGPIKKYQRVFDSKDR 604 L DAI + IKKYQR F+ KDR Sbjct: 490 LDEDAIKKLKKDIKKYQRTFEIKDR 514 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,857,420 Number of Sequences: 59808 Number of extensions: 494293 Number of successful extensions: 1060 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -