BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021348 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 27 0.74 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 3.0 AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 25 3.0 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 9.1 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 9.1 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 26.6 bits (56), Expect = 0.74 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +3 Query: 324 PSTINGVKTTIIYPATDKHIAKFSQQEVHIVLETPELYKELTLP-HLEKEQFNLQWV 491 P+T N + I+ P T + K S EV V + EL +L HL KEQ WV Sbjct: 313 PTTQNKPRPGIVAPTTIPTVPKKSLAEVGKVYDRCELANDLLHKFHLPKEQV-ATWV 368 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 482 AVGVQHSRRKSEQDRIVHDNKSEKEG 559 A G+Q S +K E+DR D + EG Sbjct: 76 AGGIQQSGKKPEKDRKPSDEDDDDEG 101 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 24.6 bits (51), Expect = 3.0 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -3 Query: 377 LISGWVDYCSFHTVYSRRRETLEVSVNIVL 288 L GW Y FH+++++ T+ + + + L Sbjct: 123 LTYGWAWYIMFHSIFAQICHTISIWLTVTL 152 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 350 SFHTVYSRRRETLEVSVNIVLE 285 S+++VYSR LE ++LE Sbjct: 356 SYYSVYSRNNCELECEAKLILE 377 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 350 SFHTVYSRRRETLEVSVNIVLE 285 S+++VYSR LE ++LE Sbjct: 356 SYYSVYSRNNCELECEAKLILE 377 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,334 Number of Sequences: 2352 Number of extensions: 12541 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -