BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021347 (635 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0181 - 26522849-26522932,26523053-26523184,26523263-265233... 30 1.3 03_05_0348 - 23346182-23348022,23348118-23348148 29 4.1 >02_05_0181 - 26522849-26522932,26523053-26523184,26523263-26523329, 26523800-26524186,26524259-26524360,26524983-26525132, 26525552-26525636,26525743-26525769,26525858-26526116, 26526659-26526751,26526921-26527013,26527122-26527289, 26527436-26527594,26528214-26528273,26528392-26528487 Length = 653 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 283 VRCKYIFEHR*KQRCKTRLSRLPSYTSKNRETIRP 387 V C+YIF H+ +Q CKT + + T N+E RP Sbjct: 125 VPCEYIFGHKDQQTCKTWVEHIK--TCINKEQDRP 157 >03_05_0348 - 23346182-23348022,23348118-23348148 Length = 623 Score = 28.7 bits (61), Expect = 4.1 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -3 Query: 429 LEDAIENVVFICTPRSDGFSVFRCITGQSREPSFASLLLPVFKNIFA-PDEFNGTPSPKL 253 L DAI +F V RC G E A+L + ++ A P+ F S + Sbjct: 185 LVDAIALGLFCVVATLGAVPVIRCAGGGPAEMVAAALDARLRDHLIAKPNLFTEAASTAV 244 Query: 252 SSFQRPL 232 +SFQRPL Sbjct: 245 ASFQRPL 251 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,266,057 Number of Sequences: 37544 Number of extensions: 290791 Number of successful extensions: 529 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -