BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021346 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 58 7e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 54 8e-08 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 50 2e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 3e-06 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 45 5e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 43 2e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 33 0.17 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 33 0.17 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 33 0.22 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.29 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 31 0.67 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 29 2.7 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 2.7 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 29 3.6 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 29 4.8 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 28 6.3 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 8.3 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 1/92 (1%) Frame = +2 Query: 239 PRLGFFSLQPFNKNFYDPHPTVLKDX-YEVEEYRNKHEVTVXGVEVHNPIQYFEEANFPD 415 P +PFNKNFY+ HP + K E+++ R K + V G P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 416 YVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLL 511 + ++ + Y +PT IQ Q PIA+SG++++ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDII 558 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = +3 Query: 519 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALV 620 KTGSGKT A++ PA+VHI +QP ++ GDGPI L+ Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLI 595 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = +2 Query: 317 YEVEEYRNKHEVTVXGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 475 +EV+ YR ++TV G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 60 HEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +3 Query: 546 YILPAIVHINNQPPIRRGDGPIALVL 623 +ILP IVHIN+QP ++ GDGPI LVL Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVL 138 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 Query: 628 PTRELAQQIQQVAADFG 678 PTRELAQQ+Q+VA G Sbjct: 140 PTRELAQQVQEVAYSVG 156 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 54.4 bits (125), Expect = 8e-08 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 284 YDPHPTVLKDXYE-VEEYRNKHEVTVXGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 460 Y HPT+ E V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 461 PIQAQGWPIAMSGKNLL 511 PIQ Q P+ +SG++++ Sbjct: 221 PIQMQVLPVLLSGRDVM 237 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 53.2 bits (122), Expect = 2e-07 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 2/86 (2%) Frame = +2 Query: 263 QPFNKNFYDPHPTVLK-DXYEVEEYRNKHE-VTVXGVEVHNPIQYFEEANFPDYVQQGVK 436 QPF K+FY P + K E +E+R E + V G P++ + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 437 TMGYKEPTPIQAQGWPIAMSGKNLLA 514 Y++PTPIQAQ P+ MSG++++A Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIA 147 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/60 (33%), Positives = 36/60 (60%) Frame = +2 Query: 332 YRNKHEVTVXGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLL 511 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +3 Query: 519 KTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVL 623 +TGSGKT A+ +P +V I P I R + GP AL+L Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALIL 184 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 625 APTRELAQQIQQVAADFGHTSYVR 696 APTRELAQQI++ FG +R Sbjct: 185 APTRELAQQIEEEILKFGRPLGIR 208 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 4/79 (5%) Frame = +2 Query: 308 KDXYEVEEYRNKHEVTVXGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQ 475 K ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q Sbjct: 133 KHQEKINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQ 192 Query: 476 GWPIAMSGKNLLAYQNGFR 532 P+ G ++GFR Sbjct: 193 ATPLMAHGPK----KSGFR 207 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 45.2 bits (102), Expect = 5e-05 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = +2 Query: 269 FNKNFYDPHPTVLKDXYEV-EEYRNKHEVTVXGVEVHNPIQYFEEANFPDYVQQGVKTMG 445 F ++YD + V + EV +E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 446 YKEPTPIQAQGWPIAMSGKNLL 511 ++ PTPIQ Q MSG++++ Sbjct: 92 FQVPTPIQMQSLSCVMSGRDII 113 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +3 Query: 519 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVL 623 +TGSGKTLAY LP + + + P GD P+AL+L Sbjct: 117 ETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALIL 151 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/72 (31%), Positives = 39/72 (54%) Frame = +2 Query: 299 TVLKDXYEVEEYRNKHEVTVXGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQG 478 + ++ E+Y ++ EV V G I FEEAN + V+ YK+PTP+Q Sbjct: 683 STIQQGINFEKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYS 741 Query: 479 WPIAMSGKNLLA 514 PI ++G++++A Sbjct: 742 IPIVIAGRDVMA 753 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 574 ITNRLFGEVMVRLLWSWAPTRELAQQIQQVAADFGHTSYVR 696 +T+ F E APTRELA QI A F H + +R Sbjct: 778 LTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGTMLR 818 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/72 (31%), Positives = 39/72 (54%) Frame = +2 Query: 299 TVLKDXYEVEEYRNKHEVTVXGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQG 478 + ++ E+Y ++ EV V G I FEEAN + V+ YK+PTP+Q Sbjct: 106 STIQQGINFEKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYS 164 Query: 479 WPIAMSGKNLLA 514 PI ++G++++A Sbjct: 165 IPIVIAGRDVMA 176 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 383 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 I F E F + + + GY+ PTP+Q PI M+G++L+A Sbjct: 478 ITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMA 521 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 519 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLGAYQRVSTTNSASCCRFWTH 683 +TGSGKT AY+LP + + Q P+AL + + ++ +F H Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDH 578 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 34.3 bits (75), Expect = 0.096 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 383 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 I FE+ + + + V GYK+PTP+Q PI ++L+A Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMA 917 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = +2 Query: 392 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 FE+ + G+ G+ +P+PIQ + P+A++G+++LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = +2 Query: 392 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 FE+ + G+ G+ +P+PIQ + P+A++G+++LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +2 Query: 383 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLL 511 ++ F + G+ G+ PT IQ QG P+A+SG+++L Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVL 91 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 519 KTGSGKTLAYILPAI 563 KTGSGKTLA+++P I Sbjct: 95 KTGSGKTLAFLIPII 109 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 425 QGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 + V +G+ PTPIQA P+A+ GK++ A Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCA 52 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 31.5 bits (68), Expect = 0.67 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +2 Query: 341 KHEVTVXGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 496 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 368 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 481 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +1 Query: 625 APTRELAQQIQQVAADFGHTSYVR 696 APTRELAQQIQ+V G +V+ Sbjct: 166 APTRELAQQIQKVVLALGDYMHVK 189 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -2 Query: 266 VGVKRIPIWASHVLPSREF 210 VGV+ I WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 225 QNMRRPDWDSFHSNLSTKTFMIHILQF 305 +N RR WDSFHSN+S + H+ F Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDF 792 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 326 EEYRNK-HEVTVXGVEVHNPIQYFEEANFPDY 418 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +3 Query: 498 ERIYWRTKTGSGKTLAYILPAIVHI-NNQPPIRRGDGPIALVL 623 E + + +TG+GKTL++ LP + + + + +RG P LV+ Sbjct: 111 EDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVM 153 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 519 KTGSGKTLAYILPAIVHINN-QPPIRRGDGPIAL 617 KTGSGKTLA+++P + + Q R G G I + Sbjct: 617 KTGSGKTLAFLVPVVELLYKLQFKTRNGTGVIII 650 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 201 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 91 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -1 Query: 630 RRPRPK-QSDHHLSE*AVGYLCAQLLARCRPTFCRNPFWYANKFFPDI 490 R+P P + + + Y + LL+ P F ++P WY F DI Sbjct: 2278 RKPHPLLRETYRATRSTFTYFASNLLSSTLPIFTKSPEWYQKCFSEDI 2325 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +3 Query: 525 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVL 623 GSGK LAY+LP I I + +GP+ L+L Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLIL 269 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 519 KTGSGKTLAYILPAIVHI 572 +TGSGKTLA+ +P I HI Sbjct: 176 ETGSGKTLAFGIPIIQHI 193 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 519 KTGSGKTLAYILPAIVHINNQPPIRRG 599 +TGSGKTLAY+ P +VH + R G Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHG 448 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 225 ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFHGYYSS 82 AL+RI + ++ C +YRR CC L +W H + Y+SS Sbjct: 197 ALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,930,726 Number of Sequences: 59808 Number of extensions: 406454 Number of successful extensions: 1047 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1044 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -