BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021341 (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 26 0.31 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 5.1 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 8.9 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 8.9 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.8 bits (54), Expect = 0.31 Identities = 15/58 (25%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 308 DTSPGRGAPRPCGSA*QNPPTPXRAKYLGDPNSQDSVGTA-ADAAMPPVCSIATGATV 138 +TS G P S +PP+P + G+ D+ + +PP S T T+ Sbjct: 116 ETSFESGKPSGVISTNTSPPSPILSNRFGENEEADAASNVISSTPLPPTTSTTTRTTL 173 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 479 CWTTRPPTLTYLRVPG 526 CW P +TYL G Sbjct: 385 CWNATPEIITYLEKNG 400 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 508 LPSCTWRRLRRRNSSPTSPCRP 573 LP+ W +++R PT P P Sbjct: 194 LPTYKWMQVKRNVPKPTVPKIP 215 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 508 LPSCTWRRLRRRNSSPTSPCRP 573 LP+ W +++R PT P P Sbjct: 194 LPTYKWMQVKRNVPKPTVPKIP 215 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,392 Number of Sequences: 336 Number of extensions: 3040 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -