BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021339 (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22690.1 68416.m02863 pentatricopeptide (PPR) repeat-containi... 29 2.1 At3g06260.1 68416.m00719 galactinol synthase, putative contains ... 28 6.5 >At3g22690.1 68416.m02863 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 978 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = -2 Query: 668 LITDAVGYGNIGIGSPKCQDQMEASEANNQQRQVKSMSRGTSCLSYTIKYGFETF 504 L +A+G N+ + S D++ A + Q++++ G SC Y ++ GFE++ Sbjct: 317 LTREALGVFNLMMDSGVRPDRISMLSAISSCSQLRNILWGKSCHGYVLRNGFESW 371 >At3g06260.1 68416.m00719 galactinol synthase, putative contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 351 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 592 KQTINSDRSKACLVEHLAYPIPLNMASKHS 503 K + D K C+V+HL P L +S+HS Sbjct: 319 KPWLRLDSRKPCIVDHLWAPYDLYRSSRHS 348 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,911,327 Number of Sequences: 28952 Number of extensions: 258861 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -