BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021336 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 27 3.4 SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|... 26 4.4 SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomy... 25 7.8 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 19 GGRAHSPPGVKWLLEPMDIYN 81 GG H P V WLL P DIY+ Sbjct: 235 GGPLHDPNTVMWLLRP-DIYS 254 >SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 443 Score = 26.2 bits (55), Expect = 4.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 215 FNINESTHLLNVKRTTANSQTLASVLRRTGKK 310 FNI + TH+L V T N L ++ R +K Sbjct: 129 FNIVDYTHILRVAMYTGNKHILEYIVARVKEK 160 >SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 25.4 bits (53), Expect = 7.8 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = -3 Query: 246 FNKCVLSFMLNN*FFIFTGGRTSCESARVGTTTLPISAVKQ*CLELISQGGWRIYVVDVH 67 +NK V F++ + + G +S V T L ISA+ + L++ G +R Y++ Sbjct: 435 WNKPVHVFLMRHVYHSSISGFKLKKSHAVLLTFL-ISALVHEFVMLLATGKFRCYILTFQ 493 Query: 66 GLQ*PLY 46 LQ PLY Sbjct: 494 LLQIPLY 500 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,734,440 Number of Sequences: 5004 Number of extensions: 51971 Number of successful extensions: 108 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -