BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021335 (589 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 111 4e-25 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 34 0.099 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 32 0.40 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_34202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 2.8 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 29 2.8 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 29 3.7 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 4.9 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 28 4.9 SB_10758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 4.9 SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) 28 4.9 SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) 28 4.9 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 27 8.6 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 111 bits (267), Expect = 4e-25 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +1 Query: 256 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPXKPW 405 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP K W Sbjct: 56 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTW 105 Score = 64.5 bits (150), Expect = 6e-11 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = +2 Query: 89 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSK 250 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNK 53 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.9 bits (74), Expect = 0.099 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 376 HHDTCYRRHPDRTYEYHHHXHAEFGRQHVQYPMIQHWF 263 HH CY H Y Y+ H H + R H YP +H++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 382 YVHHDTCYRRHPDRTYEYHHHXH 314 Y HH CY RH + Y HH H Sbjct: 25 YCHHRYCYYRHHHYCW-YRHHYH 46 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.3 bits (70), Expect = 0.30 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 361 YRRHPDRTYEYHHHXHAEFGRQHVQYPMIQH 269 Y +HP T+ YH H R H Q+P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = -1 Query: 361 YRRHPDRTYEYHHHXHAEFGRQHVQYPMIQHWFGDHLLAHAVGLPRVLGHRNVNII 194 Y +HP T+ YHH H + ++ Q+P + H + H H + + + H+ + +I Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTHRY--HQQTHKLLIVIINTHKLLIVI 465 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 352 HPDRTYEYHHHXHAEFGRQHVQYPMIQHWFGDH 254 HP T+ YH H R H Q+P + H + H Sbjct: 406 HPQVTHRYHQHPQLTH-RYHHQHPQVIHRYHQH 437 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -1 Query: 361 YRRHPDRTYEYHHHXHAEFGRQHVQYPMIQH 269 Y +HP T+ YH R Q+P + H Sbjct: 242 YHQHPQVTHRYHQQHPQVTHRYQYQHPQVTH 272 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.9 bits (69), Expect = 0.40 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 376 HHDTCYRRHPDRTYEYHHHXHAEFGRQH 293 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 385 TYVHHDTCYRRHPDRTYEYHHHXHA 311 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -1 Query: 361 YRRHPDRTYEYHHHXHAEFGRQHVQYPMIQHWFGDH 254 + H +++HHH H QH + H DH Sbjct: 6 HHHHDHHHHDHHHHDHQHHDHQHHDHQHHDHHHHDH 41 >SB_34202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 187 PGQ*CSRFYVQELEAALLREQG-GGHQTSAESWGTGRAVARIPRVRGGGT 333 P Q C + E+ +L G GG+ AE G ARI +RG GT Sbjct: 596 PAQPCKHLHSYTFESNILGNTGTGGYPGFAERGGRASYQARIQDLRGKGT 645 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 265 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 381 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.1 bits (62), Expect = 2.8 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +1 Query: 241 REQGGGH-QTSAESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPXKPW 405 R QGGG + WG G + R P GGG R G +G M GG P + W Sbjct: 50 RMQGGGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = -1 Query: 382 YVHHDTCYRRHPDRTYEYHHHXHAEFGRQHVQYPMIQHWFGDHLL 248 Y HH + H +++HHH H H + H H++ Sbjct: 257 YHHHH--HHHHQHNHHQHHHHHHHHHHNHHHHHQQHHHHHHHHII 299 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 364 CYRRHPDRTYEYHHHXHAEFGRQHVQYPMIQH 269 CY + + + YHHH H H Q+ H Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQHHHHHH 277 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.7 bits (61), Expect = 3.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 382 YVHHDTCYRRHPDRTYEYHHHXH 314 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 376 HHDTCYRRHPDRTYEYHHH 320 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 156 GRGLAAPCTVSLFSEYTDTKGRATDRLI 73 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 376 HHDTCYRRHPDRTYEYHHHXH 314 HH + RH R + YHHH + Sbjct: 570 HHHLHHHRHHHRHHHYHHHHY 590 >SB_10758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 28.3 bits (60), Expect = 4.9 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = +2 Query: 65 SSEMSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPY-- 238 S +M L R + Y+E ++ + LP V AP+ D+V +V S K S + Y Sbjct: 475 SPQMPLDFPRSFLEDYAEACANLK---QSLPQVHLAPLASDIVREVESSEVKLSLKFYVS 531 Query: 239 --CVSKEVVTK 265 C S E V K Sbjct: 532 ENCPSVEAVVK 542 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 376 HHDTCYRRHPDRTYEYHHHXH 314 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) Length = 356 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 382 YVHHDTCYRRHPDRTYEYHHHXHAEFGRQ-HVQYPMIQHWFGDH 254 Y H+D Y H Y+YH+H + H Y H+ D+ Sbjct: 299 YYHYDYYYHYHYYYYYDYHYHYDYHYHYDYHYDYHYDYHYHYDY 342 >SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) Length = 237 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -1 Query: 361 YRRHPDRTYEYHHHXHAEFGRQHVQYPMIQHWFGDH 254 +R+H +R +HHH H +P H+ H Sbjct: 190 HRQHYNRHRRHHHHHRHRHHHHHPNHPYSHHYPNHH 225 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 385 TYVHHDTCYRRHPDRTYEYHHHXHA 311 TY H DT +HPD H HA Sbjct: 323 TYTHQDTQMHKHPDTQMYVHAPRHA 347 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 27.5 bits (58), Expect = 8.6 Identities = 8/31 (25%), Positives = 12/31 (38%) Frame = -1 Query: 376 HHDTCYRRHPDRTYEYHHHXHAEFGRQHVQY 284 HH + H + +HHH H H + Sbjct: 213 HHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,560,467 Number of Sequences: 59808 Number of extensions: 314222 Number of successful extensions: 956 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -