BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021331 (490 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 27 0.34 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 25 1.4 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 25 1.8 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 24 3.2 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 22 9.8 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 27.1 bits (57), Expect = 0.34 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 4 TRPASRAILTRLSRRTESRPRAPHS*VADYT-APSSRAANTSASSDRD 144 T R+ +L +R ++R R P + V+DY+ A ++ AA +A+ +R+ Sbjct: 676 TDTIKRSHSAQLPQREDARSRTPLTAVSDYSPATAAAAAAAAAAKERE 723 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 25.0 bits (52), Expect = 1.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 169 FVQHFGRRYPGPKRPKCW 116 F++ FG ++ G KRP+ W Sbjct: 123 FLRQFGPQFTGTKRPQNW 140 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 24.6 bits (51), Expect = 1.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 425 SHASPLPAPVSENLIAPKPEPD 490 S+ PLP P EN + P+ EPD Sbjct: 59 SNTWPLPRP--ENFVEPETEPD 78 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 23.8 bits (49), Expect = 3.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 172 KFVQHFGRRYPGPKRPKCW 116 +F++ FG ++ G RP+ W Sbjct: 122 RFLRQFGPQFTGTNRPQNW 140 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.2 bits (45), Expect = 9.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 365 RTTHGRILDEPLLSLENP 418 R T +L EP +SLENP Sbjct: 919 RQTMTEVLLEPKVSLENP 936 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 392,840 Number of Sequences: 2352 Number of extensions: 7016 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -