BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021329 (671 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC041772-1|AAH41772.2| 549|Homo sapiens SPNS2 protein protein. 31 5.0 AY197607-1|AAP37476.1| 481|Homo sapiens membrane-associated pho... 30 8.7 AK128034-1|BAC87239.1| 130|Homo sapiens protein ( Homo sapiens ... 30 8.7 >BC041772-1|AAH41772.2| 549|Homo sapiens SPNS2 protein protein. Length = 549 Score = 30.7 bits (66), Expect = 5.0 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -2 Query: 349 LLMWSFIVF---FLPKYFFPFIILSQQVMGIKHNIQSATSVCITKDLYT 212 + WS + F F+P+ +F ++LS+ ++GI S + I DL+T Sbjct: 175 IFFWSAVTFSSSFIPQQYFWLLVLSRGLVGIGEASYSTIAPTIIGDLFT 223 >AY197607-1|AAP37476.1| 481|Homo sapiens membrane-associated phospholipase A1 beta protein. Length = 481 Score = 29.9 bits (64), Expect = 8.7 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 537 DTSCPYTSCSLRFQNKLLVPFETSVPSAFSFQALPQ 430 DTS Y C+ F ++VP +T + +FSF+ L Q Sbjct: 348 DTSGTYPFCTYYFVLSIIVPDKTMMDGSFSFKLLNQ 383 >AK128034-1|BAC87239.1| 130|Homo sapiens protein ( Homo sapiens cDNA FLJ46153 fis, clone TESTI4001037. ). Length = 130 Score = 29.9 bits (64), Expect = 8.7 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -2 Query: 406 LNLAFLFVTYVSLELFLFFLLMWSFIVFFLPKYF--FPFIILS 284 L L+F F ++S F + SF+ FLP + FPF+ S Sbjct: 25 LFLSFFFFLFLSFSFSFFLFSLPSFLPSFLPSFLPSFPFLFFS 67 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,352,862 Number of Sequences: 237096 Number of extensions: 1428152 Number of successful extensions: 6234 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6234 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7647512560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -