BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021323 (465 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family pr... 27 6.2 At1g10220.1 68414.m01152 hypothetical protein 27 8.3 >At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 590 Score = 27.1 bits (57), Expect = 6.2 Identities = 8/36 (22%), Positives = 23/36 (63%) Frame = +2 Query: 65 IYLVESEFKVQREIILHRFIIKKKDILFDDVINVRS 172 + ++ S +V ++ +LH F++K +++ + +I+ S Sbjct: 540 VEVINSNLEVSQDTVLHTFVVKSEELTKEKLISALS 575 >At1g10220.1 68414.m01152 hypothetical protein Length = 267 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 74 VESEFKVQREIILHRFIIKKKDILFDDVINVRS 172 V +FKV+++ +L F +K KD+L D + S Sbjct: 83 VLDDFKVKKKDVLDDFKVKNKDVLDDFNVKTES 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,505,391 Number of Sequences: 28952 Number of extensions: 115615 Number of successful extensions: 258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 258 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 782033640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -