BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021320 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 1.2 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 25 2.1 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 23 6.3 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 6.3 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 6.3 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.4 bits (53), Expect = 1.2 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 528 IRNRFGIKY*QPQPNLQRGGGXHHRAPPPEIRACRRISASVQKQQQ 391 +R R ++ QPQ Q+ R PP++R R+ ++QQQ Sbjct: 239 VRGRPSQRHRQPQQQQQQQQQQGERYVPPQLRQQRQQQQRPRQQQQ 284 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 5 RGLFRQPLPRVATYRSLLFFRTSKR 79 R R+ LPR+ YR++L F+ ++R Sbjct: 130 RHFTREALPRMDNYRNILSFQGNQR 154 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 23.0 bits (47), Expect = 6.3 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Frame = -1 Query: 237 LTLQSFI-PLSSLSD--ALKINT*LT*H-KNSRLYFDGNVPLSQITQ-FKVIGFF 88 L ++SF+ P S+L D LK N K+S+ +D N+P+S+ Q K + FF Sbjct: 412 LIMKSFLCPESTLFDQTVLKCNWWFYVDCKSSKNLYDSNLPVSKSYQLMKALSFF 466 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.0 bits (47), Expect = 6.3 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Frame = -1 Query: 237 LTLQSFI-PLSSLSD--ALKINT*LT*H-KNSRLYFDGNVPLSQITQ-FKVIGFF 88 L ++SF+ P S+L D LK N K+S+ +D N+P+S+ Q K + FF Sbjct: 420 LIMKSFLCPESTLFDQTVLKCNWWFYVDCKSSKNLYDSNLPVSKSYQLMKALSFF 474 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.0 bits (47), Expect = 6.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 288 LRSIERIIQYLVRCN 244 LRS++R +QY+ CN Sbjct: 103 LRSVQRRVQYVSYCN 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 564,716 Number of Sequences: 2352 Number of extensions: 11058 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -