BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021318 (682 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 2.2 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 8.9 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 2.2 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -2 Query: 468 LSCATTYHRSSVRIHIRCLILPHYHLTCV*YLNCSLCPANT*ATDSVR-HC 319 LS HR + + I HYH+ C LC A +D++R HC Sbjct: 493 LSGGCNLHRCKLCGKVVTHIRNHYHVHFPGRFECPLCRATYTRSDNLRTHC 543 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 408 VLDNGYVYEQTNDDRSSHT 464 + +NG + E N+D S HT Sbjct: 395 IAENGDLLETINEDESGHT 413 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,114 Number of Sequences: 2352 Number of extensions: 11719 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -