BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021317 (669 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 29 0.13 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 29 0.13 AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 29 0.13 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 29 0.13 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 29 0.13 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.2 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 25 2.2 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 25 2.2 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 25 2.2 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLALADHFDSTDLKQN 145 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLALADHFDSTDLKQN 145 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 116 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 147 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 116 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 147 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 29.1 bits (62), Expect = 0.13 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 288 NVYRQLLQTRPTHAALHLCVDLYVGGVHVKEN 193 NVY+ LL+ P H A HL + + +K+N Sbjct: 114 NVYQALLKDNPNHLAAHLAMADHFDSTDLKQN 145 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 76 SHVLNVQENIMTSNCASSPYSCEAT 150 S + VQ+NI S CASS C +T Sbjct: 3337 SGIGQVQQNIAASCCASSTIRCLST 3361 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 25.0 bits (52), Expect = 2.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 198 LSHVHRRHTNRRKGAMRRASAAFAIIDD 281 L HVH T RR+G RR S + A +D Sbjct: 137 LEHVHSGATPRRRGLTRRESNSDANDND 164 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 25.0 bits (52), Expect = 2.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 198 LSHVHRRHTNRRKGAMRRASAAFAIIDD 281 L HVH T RR+G RR S + A +D Sbjct: 137 LEHVHSGATPRRRGLTRRESNSDANDND 164 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 25.0 bits (52), Expect = 2.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 198 LSHVHRRHTNRRKGAMRRASAAFAIIDD 281 L HVH T RR+G RR S + A +D Sbjct: 23 LEHVHSGATPRRRGLTRRESNSDANDND 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,383 Number of Sequences: 2352 Number of extensions: 14397 Number of successful extensions: 72 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -