BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021311 (667 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0021 + 133473-133589,133936-134107,134662-134873 29 3.3 03_02_0034 - 5166987-5167010,5167596-5167659,5168071-5168174,516... 29 4.4 >02_01_0021 + 133473-133589,133936-134107,134662-134873 Length = 166 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 131 LHLKIKQHNKNKVRMFYMNGVFKVSGFISHSCNP 232 LH+ K+ NK VR NG F H NP Sbjct: 100 LHIAAKERNKRAVRFLIENGAFLPPDMNDHRFNP 133 >03_02_0034 - 5166987-5167010,5167596-5167659,5168071-5168174, 5168685-5168829,5168914-5169055,5169432-5169751, 5169895-5170196,5170603-5170647,5171218-5171268, 5171374-5171460,5171587-5171764,5172453-5172528, 5173018-5173234,5173604-5173909 Length = 686 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 Query: 378 NYGNRSEHTKKKNYV*MNSCNQILLRRQKIKPMLIQFKPVNKI 506 NY + SE T KK + S +LL QKI+ ++ K ++K+ Sbjct: 582 NYASVSEFTDKKINLLSKSNGNMLLSEQKIRAVVTNAKQMHKV 624 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,957,329 Number of Sequences: 37544 Number of extensions: 230067 Number of successful extensions: 268 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 268 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -